Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061530
Gene name
Locationscaffold_3:2121476..2124656
Strand+
Gene length (bp)3180
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 2.7E-165 291 798
PF16923 Glyco_hydro_63N Glycosyl hydrolase family 63 N-terminal domain 2.5E-77 21 246
PF01204 Trehalase Trehalase 8.2E-06 587 776

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 3 800 0.0E+00
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 18 797 2.0E-167
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 1 800 2.0E-122
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 1 800 5.0E-120
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 2 800 7.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 3 800 0.0E+00
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 18 797 2.0E-167
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 1 800 2.0E-122
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 1 800 5.0E-120
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 2 800 7.0E-119
sp|F4HTM3|GCS1_ARATH Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana GN=GCS1 PE=1 SV=1 12 800 5.0E-114
sp|Q84M89|GCS2_ARATH Alpha-glucosidase 2 OS=Arabidopsis thaliana GN=GCS2 PE=2 SV=1 12 800 2.0E-107
sp|Q19426|MOGS1_CAEEL Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans GN=mogs-1 PE=1 SV=2 19 798 6.0E-97
[Show less]

GO

GO Term Description Terminal node
GO:0004555 alpha,alpha-trehalase activity Yes
GO:0005991 trehalose metabolic process Yes
GO:0044262 cellular carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0015927 trehalase activity No
GO:0044237 cellular metabolic process No
GO:0016787 hydrolase activity No
GO:0005984 disaccharide metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061530
MRLALLLLLVPAALASEVNDTLLWGPYRPNLYFGLRPRLPQSLMTGLMWFGTHDYTSIQNTRHACEQNDKLDSYT
WTEFDTRQGGVQVIKDGVNNVKLTTEFLKVAGGDHGGSWAARIKGEPIDPLKPSQISTLFYFGLEGLGGLEMETE
EDENGIDGPVRLSGSTPDLDEFTLRIVDDADNKGVTSGQHAEDFEARHGKTHFVGRRLSSGDIWQAREHLLKDLV
ERARELVGPYREAEKGLPHPSWLFQLPNDVYTGSNLFAFQKSFDGPFQFDVFYESASAKQKLSSATLDQGIPALA
DAYRARFTDVFPYPKDFPTEDKDKLEGFSRAVTSNLFGGVGYFYGNSVINKKFSYEWDEEEDNAVEGDEGETGAK
LTEPKALLTATPSRSFFPRGFYWDEGFHLLHIGQWDNDFSLEILKSWIGLIDDNGWVAREQILGDEARSKVPAEF
LTQVPNYANPPTLTMAVTAFIKRLKAKKEGPSNEDLGMGFEMGTAQNVFTADGSTVESQYLNDPDLALSFLKSIY
NPLKRHYDWFRRTQRGQIKQYGRKARSRTEAYRWRGRSEMHVLTSGMDDYPRGPPHAGELHLDLISWMAFFTRTM
RDIADFIEEKEDAITYIEIEKAILNNIEDLHWNEEDQMYCDANIDDDDESYHVCHTGYLSLFPFLLELLPPNSPH
LGAILDVLRDPEQLWSQYGLRSLSKSHPEFGQGENYWKGPIWVQMNYLALRALHNTYAAQEGPYQQKAKEIYDDL
RKNVVNNVVKEYERTGYVWEQYDAVTGEGKRSHPFTGWTSLTSLILAEKY*
Coding >AgabiH97|061530
ATGCGTCTGGCGCTCCTTCTGCTGCTCGTGCCAGCCGCGTTGGCTTCAGAGGTCAATGATACCCTTCTATGGGGC
CCATACAGACCCAATCTCTATTTTGGCCTCCGGCCACGCCTACCCCAATCATTAATGACGGGGCTCATGTGGTTC
GGAACACATGATTATACTTCTATCCAAAATACTCGTCATGCTTGCGAACAAAATGATAAACTGGACTCTTATACC
TGGACAGAGTTTGATACTCGGCAAGGCGGTGTCCAAGTGATCAAGGATGGCGTAAACAATGTTAAACTCACGACC
GAGTTTCTAAAAGTCGCCGGAGGTGACCACGGCGGCAGCTGGGCAGCCCGTATCAAGGGCGAACCCATTGATCCC
TTGAAACCATCTCAAATATCCACGTTGTTCTACTTTGGTCTTGAAGGATTAGGTGGTTTAGAAATGGAGACTGAA
GAAGACGAAAACGGCATCGACGGACCTGTCAGGCTTAGTGGCTCTACTCCAGACCTAGATGAGTTCACACTCAGA
ATCGTCGATGATGCCGACAACAAGGGCGTGACGTCGGGTCAACATGCAGAAGATTTTGAAGCTAGACATGGTAAA
ACACATTTTGTCGGACGCCGATTGTCGTCTGGGGACATATGGCAAGCTAGAGAGCACCTCCTAAAGGACTTGGTC
GAGCGCGCCCGAGAATTGGTCGGACCCTACAGGGAAGCTGAGAAAGGACTGCCTCACCCCTCTTGGCTCTTCCAA
CTGCCGAATGACGTCTATACTGGGAGCAACCTGTTCGCATTCCAAAAGTCGTTTGATGGGCCCTTCCAATTTGAT
GTATTCTATGAGAGTGCAAGTGCCAAACAGAAACTGAGCTCTGCGACACTTGACCAAGGAATCCCTGCTCTTGCT
GACGCTTATAGAGCAAGGTTCACAGATGTTTTCCCATATCCTAAAGACTTTCCTACTGAAGACAAAGACAAACTT
GAAGGATTCTCTAGAGCAGTGACTTCTAACTTATTTGGCGGCGTCGGATATTTCTATGGTAATTCTGTTATTAAC
AAGAAGTTTTCTTATGAGTGGGACGAAGAGGAAGACAATGCAGTTGAAGGTGATGAGGGCGAGACGGGTGCGAAG
TTAACAGAACCCAAGGCTTTATTGACTGCCACACCAAGTCGAAGTTTCTTCCCAAGAGGTTTCTACTGGGATGAG
GGTTTCCATCTTCTCCATATTGGACAATGGGATAATGATTTCAGCTTGGAGATTCTGAAATCTTGGATTGGCCTG
ATTGATGACAACGGTTGGGTCGCTCGTGAACAAATTCTTGGCGATGAGGCGCGAAGCAAAGTTCCAGCAGAATTC
CTGACTCAGGTTCCAAACTATGCCAATCCCCCCACATTAACAATGGCTGTCACCGCGTTTATCAAGCGTCTCAAA
GCTAAGAAAGAGGGCCCTTCGAACGAAGATTTGGGAATGGGCTTCGAAATGGGTACAGCCCAAAACGTTTTTACC
GCCGACGGTTCGACTGTCGAGAGTCAATATTTGAATGATCCGGATCTCGCGCTTTCTTTCCTCAAATCGATTTAC
AACCCTTTGAAAAGGCATTATGACTGGTTCAGACGCACTCAACGGGGCCAAATCAAACAGTATGGCAGGAAAGCT
CGGTCGCGTACAGAAGCGTACAGGTGGCGTGGAAGATCGGAAATGCACGTACTCACCAGTGGTATGGATGACTAT
CCGCGAGGGCCACCCCATGCGGGAGAGTTGCATTTAGACTTGATTTCTTGGATGGCATTTTTCACAAGAACGATG
CGGGATATTGCAGACTTCATTGAAGAGAAAGAGGATGCGATTACCTATATAGAGATCGAGAAGGCTATTCTGAAC
AATATTGAAGATTTACACTGGAATGAAGAAGACCAAATGTATTGTGATGCAAATATAGATGATGACGACGAGTCA
TACCATGTCTGCCACACGGGATACCTCTCTCTATTCCCATTCCTCTTAGAGTTACTCCCCCCCAACTCTCCTCAT
TTAGGTGCTATCCTTGATGTTCTACGTGACCCTGAGCAACTGTGGTCCCAATATGGTTTGCGCAGTCTGTCGAAG
TCGCACCCCGAATTCGGGCAAGGTGAGAACTATTGGAAGGGCCCTATTTGGGTTCAAATGAACTACCTTGCTTTA
CGGGCTTTGCACAATACCTACGCGGCTCAAGAGGGGCCATACCAGCAAAAAGCGAAGGAAATCTATGACGATTTA
CGTAAAAATGTAGTGAATAATGTCGTGAAGGAGTATGAACGTACAGGATACGTTTGGGAGCAATACGATGCTGTT
ACTGGAGAGGGTAAACGAAGTCATCCATTCACTGGTTGGACATCACTAACTTCACTGATTCTCGCGGAGAAGTAC
TAA
Transcript >AgabiH97|061530
ATGCGTCTGGCGCTCCTTCTGCTGCTCGTGCCAGCCGCGTTGGCTTCAGAGGTCAATGATACCCTTCTATGGGGC
CCATACAGACCCAATCTCTATTTTGGCCTCCGGCCACGCCTACCCCAATCATTAATGACGGGGCTCATGTGGTTC
GGAACACATGATTATACTTCTATCCAAAATACTCGTCATGCTTGCGAACAAAATGATAAACTGGACTCTTATACC
TGGACAGAGTTTGATACTCGGCAAGGCGGTGTCCAAGTGATCAAGGATGGCGTAAACAATGTTAAACTCACGACC
GAGTTTCTAAAAGTCGCCGGAGGTGACCACGGCGGCAGCTGGGCAGCCCGTATCAAGGGCGAACCCATTGATCCC
TTGAAACCATCTCAAATATCCACGTTGTTCTACTTTGGTCTTGAAGGATTAGGTGGTTTAGAAATGGAGACTGAA
GAAGACGAAAACGGCATCGACGGACCTGTCAGGCTTAGTGGCTCTACTCCAGACCTAGATGAGTTCACACTCAGA
ATCGTCGATGATGCCGACAACAAGGGCGTGACGTCGGGTCAACATGCAGAAGATTTTGAAGCTAGACATGGTAAA
ACACATTTTGTCGGACGCCGATTGTCGTCTGGGGACATATGGCAAGCTAGAGAGCACCTCCTAAAGGACTTGGTC
GAGCGCGCCCGAGAATTGGTCGGACCCTACAGGGAAGCTGAGAAAGGACTGCCTCACCCCTCTTGGCTCTTCCAA
CTGCCGAATGACGTCTATACTGGGAGCAACCTGTTCGCATTCCAAAAGTCGTTTGATGGGCCCTTCCAATTTGAT
GTATTCTATGAGAGTGCAAGTGCCAAACAGAAACTGAGCTCTGCGACACTTGACCAAGGAATCCCTGCTCTTGCT
GACGCTTATAGAGCAAGGTTCACAGATGTTTTCCCATATCCTAAAGACTTTCCTACTGAAGACAAAGACAAACTT
GAAGGATTCTCTAGAGCAGTGACTTCTAACTTATTTGGCGGCGTCGGATATTTCTATGGTAATTCTGTTATTAAC
AAGAAGTTTTCTTATGAGTGGGACGAAGAGGAAGACAATGCAGTTGAAGGTGATGAGGGCGAGACGGGTGCGAAG
TTAACAGAACCCAAGGCTTTATTGACTGCCACACCAAGTCGAAGTTTCTTCCCAAGAGGTTTCTACTGGGATGAG
GGTTTCCATCTTCTCCATATTGGACAATGGGATAATGATTTCAGCTTGGAGATTCTGAAATCTTGGATTGGCCTG
ATTGATGACAACGGTTGGGTCGCTCGTGAACAAATTCTTGGCGATGAGGCGCGAAGCAAAGTTCCAGCAGAATTC
CTGACTCAGGTTCCAAACTATGCCAATCCCCCCACATTAACAATGGCTGTCACCGCGTTTATCAAGCGTCTCAAA
GCTAAGAAAGAGGGCCCTTCGAACGAAGATTTGGGAATGGGCTTCGAAATGGGTACAGCCCAAAACGTTTTTACC
GCCGACGGTTCGACTGTCGAGAGTCAATATTTGAATGATCCGGATCTCGCGCTTTCTTTCCTCAAATCGATTTAC
AACCCTTTGAAAAGGCATTATGACTGGTTCAGACGCACTCAACGGGGCCAAATCAAACAGTATGGCAGGAAAGCT
CGGTCGCGTACAGAAGCGTACAGGTGGCGTGGAAGATCGGAAATGCACGTACTCACCAGTGGTATGGATGACTAT
CCGCGAGGGCCACCCCATGCGGGAGAGTTGCATTTAGACTTGATTTCTTGGATGGCATTTTTCACAAGAACGATG
CGGGATATTGCAGACTTCATTGAAGAGAAAGAGGATGCGATTACCTATATAGAGATCGAGAAGGCTATTCTGAAC
AATATTGAAGATTTACACTGGAATGAAGAAGACCAAATGTATTGTGATGCAAATATAGATGATGACGACGAGTCA
TACCATGTCTGCCACACGGGATACCTCTCTCTATTCCCATTCCTCTTAGAGTTACTCCCCCCCAACTCTCCTCAT
TTAGGTGCTATCCTTGATGTTCTACGTGACCCTGAGCAACTGTGGTCCCAATATGGTTTGCGCAGTCTGTCGAAG
TCGCACCCCGAATTCGGGCAAGGTGAGAACTATTGGAAGGGCCCTATTTGGGTTCAAATGAACTACCTTGCTTTA
CGGGCTTTGCACAATACCTACGCGGCTCAAGAGGGGCCATACCAGCAAAAAGCGAAGGAAATCTATGACGATTTA
CGTAAAAATGTAGTGAATAATGTCGTGAAGGAGTATGAACGTACAGGATACGTTTGGGAGCAATACGATGCTGTT
ACTGGAGAGGGTAAACGAAGTCATCCATTCACTGGTTGGACATCACTAACTTCACTGATTCTCGCGGAGAAGTAC
TAA
Gene >AgabiH97|061530
ATGCGTCTGGCGCTCCTTCTGCTGCTCGTGCCAGCCGCGTTGGCTTCAGAGGTCAATGATACCCTTCTATGGGGC
CCATACAGACCCAATCTCTATTTTGGCCTCCGGCCACGCCTACCCCAATCATTAATGACGGGGCTCATGTGGTTC
GGAACACATGATTATACTTCTATCCAAAGTCGGTTGCTGTATGAATAAATGGGAGCTTTTCTTTTGCTGATACAA
GTTCCCTTGTCCAGATACTCGTCATGCTTGCGAACAAAATGATAAACTGGACTCTTATACCTGGACAGAGTTTGA
TACTCGGCAAGGCGGTGTCCAAGTGATCAAGGATGGCGTAAACAATGTTAAACTCACGACCGAGTTTCTAAAAGT
CGCCGGAGGTGACCACGGCGGCAGCTGGGCAGCCCGTATCAAGGGCGAACCCATTGATCCCTGTTTGTCCAAGTC
ACCGATTGCTTCAATTATTGCGCTAATCATCATTTCAGTGAAACCATCTCAAATATCCACGTTGTTCTACTTTGG
TCTTGAAGGATTAGGTGGTTTAGAAATGGAGACTGAAGAAGACGAAAACGTATGTCGCGCCGTGAATAGAAACAG
CTGCTGCCTAACTATCGTTCAAGGGCATCGACGGACCTGTCAGGCTTAGTGGCTCTACTCCAGACCTAGATGAGT
TCACACTCAGAATCGTCGATGGTAGATTTCTTGGTACAGTACGGTAAAGATGATGCTAAGAGACGCTCGTTAACA
GATGCCGACAACAAGGGCGTGACGTCGGGTCAACATGCAGAAGATTTTGAAGCTAGACATGGTAAAACACATTTT
GTCGGACGCCGATTGTCGTCTGGGGACATATGGCAAGCTAGAGGTGTGTCGACTCGACTTTCTCTCTTTTTTCGT
TTCATTGACTGAGTGTATGTGAAGAGCACCTCCTAAAGGACTTGGTCGAGCGCGCCCGAGAATTGGTCGGACCCT
ACAGGGAAGCTGAGAAAGGACTGCCTCACCCCTCTTGGCTCTTCCAACTGCCGAATGACGTCTATACTGGGAGCA
ACCTGTTCGCATTCCAAAAGTCGTTTGATGGGCCCTTCCAATTTGATGTATTCTATGAGAGTGCAAGTGCCAAAC
AGAAACTGAGCTGTAAGTTATTCTTGAAATTGAGCTGGGTCGGTGCTGAATCGTCCCATAGCTGCGACACTTGAC
CAAGGAATCCCTGCTCTTGCTGACGCTTATAGAGCAAGGTTCACAGATGTTTTCCCATATCCTAAAGACTTTCCT
ACTGAAGACAAAGACAAACTTGAAGGATTCTCTAGAGCAGTGACTTCTAACTTATTTGGCGGCGTCGGATATTTC
TATGGTAATTCTGTTATTAACAAGAAGTTTTCTTATGAGTGGGACGAAGAGGAAGACAATGCAGTTGAAGGTGAT
GAGGGCGAGACGGGTGCGAAGTTAACAGAACCCAAGGCTTTATTGACTGCCACACCAAGTCGAAGTTTCTTCCCA
AGAGGTTTCTACTGGTACGTATTTTTGTAATCCAAGCTCCATCAGAAGCCTTGAGCTAAACACTATGCAGGGATG
AGGGTTTCCATCTTCTCCATATTGGACAATGGGATAATGATTTCAGGCAGGTCCCTTTTCTTCACCCTGACATGA
ACCATACCTTACCATCTTCCCTGACAGCTTGGAGATTCTGAAATCTTGGATTGGCCTGATTGATGACAACGGTTG
GGTCGCTCGTGAACAAATTCTTGGCGATGAGGCGCGAAGCAAAGTTCCAGCAGAATTCCTGACTCAGGTTCCAAA
CTATGCCAATCCCCCCACATTAACAATGGCTGTCACCGCGTTTATCAAGCGTCTCAAAGCTAAGAAAGAGGGCCC
TTCGAACGAAGATTTGGGAATGGGCTTCGAAATGGGTACAGCCCAAAACGTTTTTACCGCCGACGGTTCGACTGT
CGAGAGTCAATATTTGAATGATCCGGATCTCGCGCTTTCTTTCCTCAAATCGATTTACAACCCTTTGAAAAGGCA
TTATGACTGGTTCAGACGCACTCAACGGGGCCAAATCAAACAGTATGGCAGGAAAGCTCGGTCGCGTACAGAAGC
GTACAGGTGGCGTGGAAGATCGGAAATGCACGTACTCACCAGTGGTATGGATGACTATCCGCGAGGGCCACCCCA
TGCGGGAGAGTTGCATTTAGACTTGATTTCTTGGATGGCATTTTTCACAAGAACGATGCGGGATATTGCAGACTT
CATTGAAGAGAAAGAGGATGCGATTACCTATATAGAGATCGAGAAGGCTATTCTGAACAATATTGAAGGTGAGTC
AATGTGTACTTTCTAGTGCATATGAAGGTTGACGCTGTGTTTTTCCAGATTTACACTGGAATGAAGAAGACCAAA
TGTATTGTGATGCAAATATAGATGATGACGGTAAGATAAGATTATTACATTTGTGATTTTACTTATTCAAGTTTT
TTTTCAGACGAGTCATACCATGTCTGCCACACGGGATACCTCTCTCTATTCCCATTCCTCTTAGAGTTACTCCCC
CCCAACTCTCCTCATTTAGGTGCTATCCTTGATGTTCTACGTGACCCTGAGCAACTGTGGTCCCAATATGGTTTG
CGCAGTCTGTCGAAGTCGCACCCCGAATTCGGGCAAGGTGAGAACTATTGGAAGGGCCCTATTTGGGTTCAAATG
AACTACCTTGCTTTACGGGCTTTGCACAATGTGAGTGTAGGGTTATGGGTGGAATGAGGGTTTTGATGACTGAAG
TTTGCTCGTTTACTGTAGACCTACGCGGCTCAAGAGGGGCCATACCAGCAAAAAGCGAAGGAAATCTATGACGAT
TTACGTAAAAATGTAGTGAATAATGTCGTGAAGGTTCGCTTTTCTGGATTGCAGGATTGTTTGGCATGTTTCTCA
TGAGCTTGTTTGCAGGAGTATGAACGTACAGGATACGTTTGGGAGCAATACGATGCTGTTACTGGAGAGGGTAAA
CGAAGGTAAGTCGGATGCGCTCAGGGTTGGTATTGAATACTGACGCAGGTGCAGTCATCCATTCACTGGTTGGAC
ATCACTAACTTCACTGAGTATGTTGTTCCATGCCTTCTCGTGTTACAGAGTAAGATGCTGATGACGCGTATTTCG
CGTATTTCAGTTCTCGCGGAGAAGTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail