Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061460
Gene name
Locationscaffold_3:2109206..2110236
Strand+
Gene length (bp)1030
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family 2.9E-05 54 146

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 50 158 2.0E-12
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 50 168 1.0E-11

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0009055 electron transfer activity Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061460
MNFKIFASLALVQLVAAQYGYPPTTPTTATTAAAASTPSIPPNSPGQWNIEVAAGNQFVFGQPNITAKVGDNVTW
HFPNNGIEHSVTQSSFNDPCVRLAASGNNTGGFDSTLTAGTTFTIMITDTNPIWYHCKQIMHCGMGMVGSINAPS
SGNTYDSFLAAAKAIGQNEQLESDTGTPVLTGVGAVATAGPMSATAGGGSGGSGAGASSGNSANTSGALRHFTES
GWYLATALIIVSVL*
Coding >AgabiH97|061460
ATGAATTTCAAGATATTTGCAAGTCTGGCGCTTGTTCAGCTTGTAGCTGCTCAGTATGGTTACCCACCGACGACA
CCGACAACAGCGACTACTGCTGCTGCTGCAAGCACCCCTTCCATCCCCCCCAACTCTCCTGGACAATGGAATATC
GAGGTCGCTGCTGGAAATCAATTTGTCTTTGGTCAACCGAACATCACAGCCAAAGTGGGCGACAATGTTACTTGG
CATTTCCCAAACAATGGCATTGAACATTCGGTGACGCAGTCGAGTTTCAATGATCCATGTGTTCGTCTTGCAGCA
AGCGGGAACAACACTGGAGGATTCGATTCCACGTTGACAGCGGGAACTACATTCACGATTATGATCACAGACACC
AATCCTATCTGGTATCACTGTAAACAAATAATGCATTGTGGAATGGGAATGGTTGGCAGTATCAACGCACCCTCG
TCGGGAAATACATATGACAGCTTCCTAGCTGCTGCGAAGGCAATTGGCCAGAACGAACAGCTGGAATCCGATACT
GGCACACCAGTGTTGACGGGTGTAGGCGCTGTAGCGACTGCGGGTCCTATGAGTGCAACTGCCGGTGGTGGCAGT
GGTGGCAGTGGTGCCGGTGCCAGTTCTGGCAACAGTGCCAATACTTCAGGCGCACTGAGACATTTCACTGAATCA
GGCTGGTACCTGGCTACTGCGCTTATTATCGTATCGGTGCTTTGA
Transcript >AgabiH97|061460
ATGAATTTCAAGATATTTGCAAGTCTGGCGCTTGTTCAGCTTGTAGCTGCTCAGTATGGTTACCCACCGACGACA
CCGACAACAGCGACTACTGCTGCTGCTGCAAGCACCCCTTCCATCCCCCCCAACTCTCCTGGACAATGGAATATC
GAGGTCGCTGCTGGAAATCAATTTGTCTTTGGTCAACCGAACATCACAGCCAAAGTGGGCGACAATGTTACTTGG
CATTTCCCAAACAATGGCATTGAACATTCGGTGACGCAGTCGAGTTTCAATGATCCATGTGTTCGTCTTGCAGCA
AGCGGGAACAACACTGGAGGATTCGATTCCACGTTGACAGCGGGAACTACATTCACGATTATGATCACAGACACC
AATCCTATCTGGTATCACTGTAAACAAATAATGCATTGTGGAATGGGAATGGTTGGCAGTATCAACGCACCCTCG
TCGGGAAATACATATGACAGCTTCCTAGCTGCTGCGAAGGCAATTGGCCAGAACGAACAGCTGGAATCCGATACT
GGCACACCAGTGTTGACGGGTGTAGGCGCTGTAGCGACTGCGGGTCCTATGAGTGCAACTGCCGGTGGTGGCAGT
GGTGGCAGTGGTGCCGGTGCCAGTTCTGGCAACAGTGCCAATACTTCAGGCGCACTGAGACATTTCACTGAATCA
GGCTGGTACCTGGCTACTGCGCTTATTATCGTATCGGTGCTTTGA
Gene >AgabiH97|061460
ATGAATTTCAAGATATTTGCAAGTCTGGCGCTTGTTCAGCTTGTAGCTGCTCAGTATGGTTACCCACCGACGACA
CCGACAACAGCGACTACTGCTGCTGCTGCAAGCACCCCTTCCATCCCCCCCAACTCTCCTGGACAATGGAATGTC
AGTGTTTCATATCGCCATAAAACCATCTCGCTAACCGGATACGCCTTCCAGATCGAGGTCGCTGCTGGAAATCAA
TTTGTCTTTGGTCAACCGAACATCACAGCCAAAGTGGGCGACAATGTTACTTGGCATTTCCCAAAGTACGTTCTC
GCGTTTGCTTGACCGGCTGCAGAATCCATATGAACATTTGACTCGCAGCAATGGCATTGAACATTCGGTGACGCA
GTCGAGTTTCAATGATCCATGTGTTCGTCTTGCAGCAAGCGGGAACAACACTGGAGGATTCGATTCCACGTTGAC
AGCGGGAACTACATTCACGATTATGATCACAGACACCAATCGTAAGTGCTCGCCAAATGTGTGGAAAGCGACATA
GTAACGTTCTTTTCATGTTTTATCAACCTGTAACAGCTATCTGGTATCACTGTAAACAAGTGAGTATTTGGCAAA
TATCAGACTGGTCAAGATGGCTGATGCATGGATATCTTTAGATAATGCATTGTGGAATGGGAATGGTTGGCAGTA
TCAACGCACCCTCGTCGGGAAATACATATGACAGCTTCCTAGCTGCTGCGAAGGCAATTGGCCAGAACGAACAGC
TGGTGAGTCTACTTTACTACGATTGTCGTTGCATTTTTTGGACACGCACCTTACTTTGAACGTTACTTTATAGGA
ATCCGATACTGGCACACCAGTGTTGACGGGTGTAGGCGCTGTAGCGACTGCGGGTCCTATGAGTGCAACTGCCGG
TGGTGGCAGTGGTGGCAGTGGTGCCGGTGCCAGTTCTGGCAACAGTGCCAATACTTCAGGCGCACTGAGACATTT
CACTGAATCAGGCTGGTACCTGGCTACTGCGCTTATTATCGTATCGGTGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail