Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061390
Gene name
Locationscaffold_3:2088951..2090674
Strand+
Gene length (bp)1723
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 1.6E-06 58 102
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 1.2E-06 234 364

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 231 253 22
2 266 288 22
3 298 320 22
4 341 363 22
5 383 402 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061390
MLLPSLLPAIISLLCLQYLPTVSALKGDSGCNMFICVNATLGENNRITYQLTGLYPPIGWLALGWGGKMEGTPMV
VVWPNDDGTFSLSHRYGRPNHVEPVFIPTPLRVARAIPPGASSWHPEGSIRMAFDMRANLTALAEDPVEHLIWAY
GMTNPGSKLLNTELLAHYQAGFLNIDFSKEAVPMPPPFDGQQTTSGNGGNNVPPPPNAGNSATVHSTVGPTTSFG
GHEKLIVAHGVLLSFGFLVLLPAGSLIARWSRTFTVKWFKAHSIINMSIALPIIVIGWLFGPLAVASSEGSHFLS
THQICGLFLPPLYFLQIWLGRYIHRRKAEGLVLKDVPHPPSNLLHAGFGLLIIGFAFFQVRSGLELWDKATGRDP
LDDWCHDLWLAWTVVLPVAYIAGLSLLPRQFYQERMQVMPGGSFYVALDRADSPLLSEAGIYGESHAQFTNSRAT
MDPVTFRASEAQNQ*
Coding >AgabiH97|061390
ATGCTTCTGCCATCTCTCCTGCCAGCAATTATTTCGTTGCTGTGTTTGCAGTACCTCCCCACAGTTTCAGCCCTC
AAAGGCGACTCGGGATGTAACATGTTCATCTGTGTCAATGCCACTCTTGGCGAGAATAATCGGATAACTTATCAG
TTGACAGGTCTGTATCCGCCCATTGGATGGTTGGCGCTTGGATGGGGCGGTAAAATGGAGGGCACGCCCATGGTC
GTAGTGTGGCCAAATGACGATGGCACATTCTCGCTTTCACATCGATATGGTAGACCCAACCATGTCGAGCCCGTA
TTCATTCCAACTCCCCTTCGAGTTGCGAGGGCCATACCCCCAGGAGCATCATCGTGGCATCCTGAAGGTTCTATT
CGCATGGCGTTCGACATGCGAGCGAATTTGACTGCATTGGCAGAAGACCCAGTTGAACATTTAATCTGGGCGTAT
GGCATGACCAATCCCGGATCTAAGCTACTAAACACGGAACTCCTAGCTCATTATCAAGCTGGGTTCCTCAACATC
GACTTTTCCAAGGAGGCGGTCCCAATGCCACCGCCGTTCGACGGTCAACAGACCACATCAGGCAACGGTGGTAAC
AACGTGCCACCCCCTCCCAATGCTGGGAACTCGGCGACAGTACACTCGACAGTTGGCCCTACGACTTCGTTTGGC
GGCCACGAAAAACTTATCGTTGCACACGGCGTTTTGCTTTCATTTGGTTTCCTCGTGCTCTTGCCCGCAGGATCC
CTTATTGCGCGTTGGTCGCGGACCTTTACCGTAAAATGGTTCAAGGCCCATTCAATCATCAATATGTCGATTGCA
CTACCCATAATCGTCATAGGATGGCTGTTCGGCCCTCTCGCAGTCGCTAGCAGCGAAGGTTCACACTTTCTCTCA
ACGCATCAGATTTGTGGATTGTTCCTGCCCCCCTTATATTTCCTACAAATATGGCTGGGACGCTATATTCATCGC
AGAAAGGCAGAAGGGTTGGTACTCAAGGATGTTCCCCATCCTCCTTCAAATCTTCTTCACGCCGGCTTTGGCCTT
CTCATTATCGGATTTGCTTTCTTCCAAGTGAGAAGTGGTCTTGAACTATGGGACAAAGCAACAGGGCGAGACCCA
TTAGACGATTGGTGCCATGACCTTTGGCTTGCGTGGACGGTGGTGTTACCAGTCGCTTATATCGCTGGTCTATCT
CTTTTGCCCCGTCAATTCTACCAGGAACGTATGCAAGTCATGCCGGGCGGTAGCTTCTACGTCGCACTTGACCGT
GCGGATTCACCTCTTCTCTCGGAGGCTGGCATCTACGGAGAAAGTCACGCTCAATTCACCAACTCGCGGGCCACG
ATGGATCCAGTGACCTTCAGGGCCTCCGAAGCCCAAAATCAGTGA
Transcript >AgabiH97|061390
ATGCTTCTGCCATCTCTCCTGCCAGCAATTATTTCGTTGCTGTGTTTGCAGTACCTCCCCACAGTTTCAGCCCTC
AAAGGCGACTCGGGATGTAACATGTTCATCTGTGTCAATGCCACTCTTGGCGAGAATAATCGGATAACTTATCAG
TTGACAGGTCTGTATCCGCCCATTGGATGGTTGGCGCTTGGATGGGGCGGTAAAATGGAGGGCACGCCCATGGTC
GTAGTGTGGCCAAATGACGATGGCACATTCTCGCTTTCACATCGATATGGTAGACCCAACCATGTCGAGCCCGTA
TTCATTCCAACTCCCCTTCGAGTTGCGAGGGCCATACCCCCAGGAGCATCATCGTGGCATCCTGAAGGTTCTATT
CGCATGGCGTTCGACATGCGAGCGAATTTGACTGCATTGGCAGAAGACCCAGTTGAACATTTAATCTGGGCGTAT
GGCATGACCAATCCCGGATCTAAGCTACTAAACACGGAACTCCTAGCTCATTATCAAGCTGGGTTCCTCAACATC
GACTTTTCCAAGGAGGCGGTCCCAATGCCACCGCCGTTCGACGGTCAACAGACCACATCAGGCAACGGTGGTAAC
AACGTGCCACCCCCTCCCAATGCTGGGAACTCGGCGACAGTACACTCGACAGTTGGCCCTACGACTTCGTTTGGC
GGCCACGAAAAACTTATCGTTGCACACGGCGTTTTGCTTTCATTTGGTTTCCTCGTGCTCTTGCCCGCAGGATCC
CTTATTGCGCGTTGGTCGCGGACCTTTACCGTAAAATGGTTCAAGGCCCATTCAATCATCAATATGTCGATTGCA
CTACCCATAATCGTCATAGGATGGCTGTTCGGCCCTCTCGCAGTCGCTAGCAGCGAAGGTTCACACTTTCTCTCA
ACGCATCAGATTTGTGGATTGTTCCTGCCCCCCTTATATTTCCTACAAATATGGCTGGGACGCTATATTCATCGC
AGAAAGGCAGAAGGGTTGGTACTCAAGGATGTTCCCCATCCTCCTTCAAATCTTCTTCACGCCGGCTTTGGCCTT
CTCATTATCGGATTTGCTTTCTTCCAAGTGAGAAGTGGTCTTGAACTATGGGACAAAGCAACAGGGCGAGACCCA
TTAGACGATTGGTGCCATGACCTTTGGCTTGCGTGGACGGTGGTGTTACCAGTCGCTTATATCGCTGGTCTATCT
CTTTTGCCCCGTCAATTCTACCAGGAACGTATGCAAGTCATGCCGGGCGGTAGCTTCTACGTCGCACTTGACCGT
GCGGATTCACCTCTTCTCTCGGAGGCTGGCATCTACGGAGAAAGTCACGCTCAATTCACCAACTCGCGGGCCACG
ATGGATCCAGTGACCTTCAGGGCCTCCGAAGCCCAAAATCAGTGA
Gene >AgabiH97|061390
ATGCTTCTGCCATCTCTCCTGCCAGCAATTATTTCGTTGCTGTGTTTGCAGTACCTCCCCACAGTTTCAGCCCTC
AAAGGCGACTCGGGATGTAACATGTTCATCTGTGTCAATGCCACTCTTGGCGAGAATAATCGGATAACTTGTAAT
TTCTTTTTCATCTCAATGTGAGCCGGTTGGCTGACTTGGACCTTTAGATCAGTTGACAGGTCTGTATCCGCCCAT
TGGATGGTTGGCGCTGTAAGTGCATTCAAGTTTCATCTTGGGACCAATGACTCAAGACTTACAGTGGATGGGGCG
GTAAAATGGAGGGCACGCCCATGGTCGTAGTGTGGCCAAATGACGATGGCACATTCTCGCTTTCACATCGATATG
GTAGACCCAACCATGTCGAGCCCGTATTCATTCCAACTCCCCTTCGAGTTGCGAGGGCCATACCCCCAGGAGCAT
CATCGGTGAATATACCCGGTTTTTACACTACTGTCTTGTTACTGAACGTGCTTTGGTTAAGTGGCATCCTGAAGG
TTCTATTCGCATGGCGTTCGACATGCGAGCGAATTTGACTGCATTGGCAGAAGACCCAGTTGAACATTTAATCTG
GGCGTATGGCATGACCAATCCCGGATCTAAGCTACTAAACACGGAACTCCTAGCTCATTATCAAGCTGGGTTCCT
CAACATCGACTTTTCCAAGGAGGCGGTCCCAATGCCACCGCCGTTCGACGGTCAACAGACCACATCAGGCAACGG
TGGTAACAACGTGCCACCCCCTCCCAATGCTGGGAACTCGGCGACAGTACACTCGACAGTTGGCCCTACGACTTC
GTTTGGCGGCCACGAAAAACTTATCGTTGCACACGGCGTTTTGCTTTCATTTGGTTTCCTCGTGCTCTTGCCCGC
AGGATCCCTTATTGCGCGTTGGTCGCGGACCTTTACCGTAAAATGGTTCAAGGCCCATTCAATCATCAATATGTC
GATTGCACTACCCATAATCGTCATAGGATGGCTGTTCGGCCCTCTCGCAGTCGCTAGCAGCGAAGGTTCACACTT
TCTCTCAACGCATCAGGTAAAATCCTTTACCAATCACTTTCACTCGGCTCATTCACGTTTCTGAAATAGATTTGT
GGATTGTTCCTGCCCCCCTTATATTTCCTACAAATATGGCTGGGACGCTATATTCATCGCAGAAAGGCAGAAGGG
TTGGTACTCAAGGATGTTCCCCATCCTCCTTCAAATCTTCTTCACGCCGGCTTTGGCCTTCTCATTATCGGATTT
GCTTTCTTCCAAGTACGTCTATATCGCATTAACATGTGGGCCATTTGAAATTAATCCCATTTCCTAAGGTGAGAA
GTGGTCTTGAACTATGGGACAAAGCAACAGGGCGAGACCCATTAGACGATTGGTGCCATGACCTTTGGCTTGCGT
GGACGGTGGTAGGTCTTTTCTTTTACCGAAACTTTACCCCGTCTTAACCCCCCTCTTTTTTAAAAATCAGGTGTT
ACCAGTCGCTTATATCGCTGGTCTATCTCTTTTGCCCCGTCAATTCTACCAGGAACGTATGCAAGTCATGCCGGG
CGGTAGCTTCTACGTCGCACTTGACCGTGCGGATTCACCTCTTCTCTCGGAGGCTGGCATCTACGGAGAAAGTCA
CGCTCAATTCACCAACTCGCGGGCCACGATGGATCCAGTGACCTTCAGGGCCTCCGAAGCCCAAAATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail