Protein ID | AgabiH97|061130 |
Gene name | |
Location | scaffold_3:2034214..2034857 |
Strand | - |
Gene length (bp) | 643 |
Transcript length (bp) | 534 |
Coding sequence length (bp) | 534 |
Protein length (aa) | 178 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF04603 | Mog1 | Ran-interacting Mog1 protein | 5.7E-38 | 6 | 140 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q32PE2|MOG1_BOVIN | Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 | 1 | 177 | 2.0E-20 |
sp|Q9HD47|MOG1_HUMAN | Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 | 7 | 177 | 4.0E-20 |
sp|Q9JIB0|MOG1_MOUSE | Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 | 7 | 177 | 3.0E-19 |
sp|Q54ML6|MOG1_DICDI | Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 | 5 | 176 | 1.0E-16 |
sp|O75002|MOG1_SCHPO | Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 | 6 | 177 | 2.0E-14 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q32PE2|MOG1_BOVIN | Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 | 1 | 177 | 2.0E-20 |
sp|Q9HD47|MOG1_HUMAN | Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 | 7 | 177 | 4.0E-20 |
sp|Q9JIB0|MOG1_MOUSE | Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 | 7 | 177 | 3.0E-19 |
sp|Q54ML6|MOG1_DICDI | Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 | 5 | 176 | 1.0E-16 |
sp|O75002|MOG1_SCHPO | Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 | 6 | 177 | 2.0E-14 |
sp|P47123|MOG1_YEAST | Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 | 7 | 177 | 1.0E-12 |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm | Peroxisomal targeting signal | 0.6523 | 0.5141 | 0.0378 | 0.012 | 0.0497 | 0.0081 | 0.1683 | 0.0535 | 0.1475 | 0.0175 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 115.60 | 66.81 | 164.40 |
Initials | Initials knots | 106.24 | 60.53 | 151.95 |
Pileal_Stipeal_center | Stage I stipe center | 84.62 | 46.91 | 122.33 |
Pileal_Stipeal_shell | Stage I stipe shell | 114.16 | 65.83 | 162.50 |
DIF_stipe_center | Stage II stipe center | 80.44 | 44.75 | 116.12 |
DIF_stipe_shell | Stage II stipe shell | 69.52 | 37.92 | 101.11 |
DIF_stipe_skin | Stage II stipe skin | 74.03 | 40.58 | 107.48 |
DIF_cap_skin | Stage II cap skin | 107.40 | 61.51 | 153.28 |
DIF_cap_tissue | Stage II cap tissue | 102.35 | 57.92 | 146.79 |
DIF_gill_tissue | Stage II gill tissue | 107.86 | 61.81 | 153.91 |
YFB_stipe_center | Young fruiting body stipe center | 92.70 | 52.17 | 133.23 |
YFB_stipe_shell | Young fruiting body stipe shell | 70.75 | 38.40 | 103.09 |
YFB_stipe_skin | Young fruiting body stipe skin | 70.65 | 38.56 | 102.75 |
YFB_cap_skin | Young fruiting body cap skin | 114.41 | 66.05 | 162.77 |
YFB_cap_tissue | Young fruiting body cap tissue | 117.31 | 67.75 | 166.87 |
YFB_gill_tissue | Young fruiting body gill tissue | 106.99 | 61.24 | 152.74 |
YFB_veil | Young fruiting body veil | 104.47 | 59.42 | 149.51 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.894211 | no |
Casing | YFB_stipe_center | 0.570600 | no |
Casing | YFB_stipe_shell | 0.114888 | no |
Casing | YFB_stipe_skin | 0.113966 | no |
Casing | YFB_cap_skin | 0.985941 | no |
Casing | YFB_cap_tissue | 0.979912 | no |
Casing | YFB_gill_tissue | 0.883055 | no |
Casing | YFB_veil | 0.840880 | no |
Casing | Initials | 0.867084 | no |
Casing | Pileal_Stipeal_center | 0.381016 | no |
Casing | Pileal_Stipeal_shell | 0.983046 | no |
Casing | DIF_stipe_center | 0.280162 | no |
Casing | DIF_stipe_shell | 0.099595 | no |
Casing | DIF_stipe_skin | 0.148512 | no |
Casing | DIF_cap_skin | 0.888660 | no |
Casing | DIF_cap_tissue | 0.800245 | no |
DIF_gill_tissue | YFB_stipe_center | 0.732335 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.196632 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.190496 | no |
DIF_gill_tissue | YFB_cap_skin | 0.916488 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.871441 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.988350 | no |
DIF_gill_tissue | YFB_veil | 0.956502 | no |
YFB_stipe_center | YFB_stipe_shell | 0.488790 | no |
YFB_stipe_center | YFB_stipe_skin | 0.479328 | no |
YFB_stipe_center | YFB_cap_skin | 0.600264 | no |
YFB_stipe_center | YFB_cap_tissue | 0.546079 | no |
YFB_stipe_center | YFB_gill_tissue | 0.751835 | no |
YFB_stipe_center | YFB_veil | 0.808105 | no |
YFB_stipe_shell | YFB_stipe_skin | 0.997742 | no |
YFB_stipe_shell | YFB_cap_skin | 0.127489 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.097776 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.198538 | no |
YFB_stipe_shell | YFB_veil | 0.247691 | no |
YFB_stipe_skin | YFB_cap_skin | 0.126467 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.095644 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.198663 | no |
YFB_stipe_skin | YFB_veil | 0.244377 | no |
YFB_cap_skin | YFB_cap_tissue | 0.965513 | no |
YFB_cap_skin | YFB_gill_tissue | 0.899960 | no |
YFB_cap_skin | YFB_veil | 0.859320 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.855184 | no |
YFB_cap_tissue | YFB_veil | 0.810684 | no |
YFB_gill_tissue | YFB_veil | 0.968401 | no |
Initials | DIF_gill_tissue | 0.977679 | no |
Initials | YFB_stipe_center | 0.765110 | no |
Initials | YFB_stipe_shell | 0.221819 | no |
Initials | YFB_stipe_skin | 0.215396 | no |
Initials | YFB_cap_skin | 0.887917 | no |
Initials | YFB_cap_tissue | 0.843944 | no |
Initials | YFB_gill_tissue | 0.989292 | no |
Initials | YFB_veil | 0.977033 | no |
Initials | Pileal_Stipeal_center | 0.566822 | no |
Initials | Pileal_Stipeal_shell | 0.890065 | no |
Initials | DIF_stipe_center | 0.450665 | no |
Initials | DIF_stipe_shell | 0.195682 | no |
Initials | DIF_stipe_skin | 0.277880 | no |
Initials | DIF_cap_skin | 0.983860 | no |
Initials | DIF_cap_tissue | 0.948641 | no |
Pileal_Stipeal_center | DIF_gill_tissue | 0.533228 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.863469 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.702303 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.697022 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.404208 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.352768 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 0.551685 | no |
Pileal_Stipeal_center | YFB_veil | 0.619792 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.410792 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.932469 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.661774 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.785863 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.544343 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.664245 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.915114 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.597521 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.128665 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.125875 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.996834 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.961958 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.904295 | no |
Pileal_Stipeal_shell | YFB_veil | 0.864937 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.296901 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.110080 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.164492 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.909479 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.824726 | no |
DIF_stipe_center | DIF_gill_tissue | 0.419197 | no |
DIF_stipe_center | YFB_stipe_center | 0.761766 | no |
DIF_stipe_center | YFB_stipe_shell | 0.801735 | no |
DIF_stipe_center | YFB_stipe_skin | 0.798208 | no |
DIF_stipe_center | YFB_cap_skin | 0.304591 | no |
DIF_stipe_center | YFB_cap_tissue | 0.256965 | no |
DIF_stipe_center | YFB_gill_tissue | 0.435788 | no |
DIF_stipe_center | YFB_veil | 0.499736 | no |
DIF_stipe_center | DIF_stipe_shell | 0.766930 | no |
DIF_stipe_center | DIF_stipe_skin | 0.878244 | no |
DIF_stipe_center | DIF_cap_skin | 0.434185 | no |
DIF_stipe_center | DIF_cap_tissue | 0.546138 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.177815 | no |
DIF_stipe_shell | YFB_stipe_center | 0.448703 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.978374 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.980135 | no |
DIF_stipe_shell | YFB_cap_skin | 0.117324 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.089805 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.184076 | no |
DIF_stipe_shell | YFB_veil | 0.231748 | no |
DIF_stipe_shell | DIF_stipe_skin | 0.913164 | no |
DIF_stipe_shell | DIF_cap_skin | 0.181205 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.265454 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.248439 | no |
DIF_stipe_skin | YFB_stipe_center | 0.568904 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.938788 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.936996 | no |
DIF_stipe_skin | YFB_cap_skin | 0.165288 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.135006 | no |
DIF_stipe_skin | YFB_gill_tissue | 0.259163 | no |
DIF_stipe_skin | YFB_veil | 0.312117 | no |
DIF_stipe_skin | DIF_cap_skin | 0.256658 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.359174 | no |
DIF_cap_skin | DIF_gill_tissue | 0.992827 | no |
DIF_cap_skin | YFB_stipe_center | 0.743856 | no |
DIF_cap_skin | YFB_stipe_shell | 0.201033 | no |
DIF_cap_skin | YFB_stipe_skin | 0.194366 | no |
DIF_cap_skin | YFB_cap_skin | 0.909397 | no |
DIF_cap_skin | YFB_cap_tissue | 0.865216 | no |
DIF_cap_skin | YFB_gill_tissue | 0.994029 | no |
DIF_cap_skin | YFB_veil | 0.963352 | no |
DIF_cap_skin | DIF_cap_tissue | 0.934190 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.925187 | no |
DIF_cap_tissue | YFB_stipe_center | 0.843154 | no |
DIF_cap_tissue | YFB_stipe_shell | 0.292131 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.284448 | no |
DIF_cap_tissue | YFB_cap_skin | 0.820640 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.771042 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.939658 | no |
DIF_cap_tissue | YFB_veil | 0.973017 | no |
Orthofinder run ID | 1 |
Orthogroup | 4099 |
Change Orthofinder run |
Species | Protein ID |
---|---|
Agaricus bisporus var bisporus H39 | AgabiH39|061130 |
Agaricus bisporus var bisporus H97 | AgabiH97|061130 (this protein) |
Rhodonia placenta FPRL280 | RhoplFPRL280|24_57 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|061130 MSVTRRLFGGAITANTAPDLLDASDFRQVPDNQEVFMYPHSIVSIIFEVLQAVDEQDDRKAARFHFDSVAHDNDA ELSQVEEINVVPHERGDLTPSPIVLRGTQTVRKFNRKELDTIQILMALYRVKDRKADLVVTFNIPIESEDPGVAT EVQVQRVIDDFKEVVKSLEIKDFNLFA* |
Coding | >AgabiH97|061130 ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA TTTGCGTGA |
Transcript | >AgabiH97|061130 ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA TTTGCGTGA |
Gene | >AgabiH97|061130 ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCGTAT GTCGATCTCGTTCCTGTAATACAGCCACTGCTCATCATAGGACGCTAGCGATTTCCGCCAGGTCCCAGATAATCA AGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTACAAGCTGTAGATGAACAGGACGA TAGAAAAGCCGCCAGGCATGTTTCATTGTATTCCAACAGTTTCAGCAGCTCTCAAATCACACGCTTTCTCAGATT TCACTTTGATTCAGTTGCACACGATAACGATGCAGAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGA GAGAGGTGATTTAACTCCATCTCCCATCGTACTTCGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACT CGACACGATCCAAATCCTAATGGCGCTATATCGGGTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACAT TCCTATCGAGTCAGAAGATCCAGGTGTAGCCACTGAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGT TGTCAAATCCCTAGAGATCAAAGACTTTAATCTATTTGCGTGA |