Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061130
Gene name
Locationscaffold_3:2034214..2034857
Strand-
Gene length (bp)643
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04603 Mog1 Ran-interacting Mog1 protein 5.7E-38 6 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 177 2.0E-20
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 7 177 4.0E-20
sp|Q9JIB0|MOG1_MOUSE Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 7 177 3.0E-19
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 5 176 1.0E-16
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 6 177 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 177 2.0E-20
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 7 177 4.0E-20
sp|Q9JIB0|MOG1_MOUSE Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 7 177 3.0E-19
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 5 176 1.0E-16
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 6 177 2.0E-14
sp|P47123|MOG1_YEAST Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 7 177 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 115.60 66.81 164.40
Initials Initials knots 106.24 60.53 151.95
Pileal_Stipeal_center Stage I stipe center 84.62 46.91 122.33
Pileal_Stipeal_shell Stage I stipe shell 114.16 65.83 162.50
DIF_stipe_center Stage II stipe center 80.44 44.75 116.12
DIF_stipe_shell Stage II stipe shell 69.52 37.92 101.11
DIF_stipe_skin Stage II stipe skin 74.03 40.58 107.48
DIF_cap_skin Stage II cap skin 107.40 61.51 153.28
DIF_cap_tissue Stage II cap tissue 102.35 57.92 146.79
DIF_gill_tissue Stage II gill tissue 107.86 61.81 153.91
YFB_stipe_center Young fruiting body stipe center 92.70 52.17 133.23
YFB_stipe_shell Young fruiting body stipe shell 70.75 38.40 103.09
YFB_stipe_skin Young fruiting body stipe skin 70.65 38.56 102.75
YFB_cap_skin Young fruiting body cap skin 114.41 66.05 162.77
YFB_cap_tissue Young fruiting body cap tissue 117.31 67.75 166.87
YFB_gill_tissue Young fruiting body gill tissue 106.99 61.24 152.74
YFB_veil Young fruiting body veil 104.47 59.42 149.51

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.894211 no
Casing YFB_stipe_center 0.570600 no
Casing YFB_stipe_shell 0.114888 no
Casing YFB_stipe_skin 0.113966 no
Casing YFB_cap_skin 0.985941 no
Casing YFB_cap_tissue 0.979912 no
Casing YFB_gill_tissue 0.883055 no
Casing YFB_veil 0.840880 no
Casing Initials 0.867084 no
Casing Pileal_Stipeal_center 0.381016 no
Casing Pileal_Stipeal_shell 0.983046 no
Casing DIF_stipe_center 0.280162 no
Casing DIF_stipe_shell 0.099595 no
Casing DIF_stipe_skin 0.148512 no
Casing DIF_cap_skin 0.888660 no
Casing DIF_cap_tissue 0.800245 no
DIF_gill_tissue YFB_stipe_center 0.732335 no
DIF_gill_tissue YFB_stipe_shell 0.196632 no
DIF_gill_tissue YFB_stipe_skin 0.190496 no
DIF_gill_tissue YFB_cap_skin 0.916488 no
DIF_gill_tissue YFB_cap_tissue 0.871441 no
DIF_gill_tissue YFB_gill_tissue 0.988350 no
DIF_gill_tissue YFB_veil 0.956502 no
YFB_stipe_center YFB_stipe_shell 0.488790 no
YFB_stipe_center YFB_stipe_skin 0.479328 no
YFB_stipe_center YFB_cap_skin 0.600264 no
YFB_stipe_center YFB_cap_tissue 0.546079 no
YFB_stipe_center YFB_gill_tissue 0.751835 no
YFB_stipe_center YFB_veil 0.808105 no
YFB_stipe_shell YFB_stipe_skin 0.997742 no
YFB_stipe_shell YFB_cap_skin 0.127489 no
YFB_stipe_shell YFB_cap_tissue 0.097776 no
YFB_stipe_shell YFB_gill_tissue 0.198538 no
YFB_stipe_shell YFB_veil 0.247691 no
YFB_stipe_skin YFB_cap_skin 0.126467 no
YFB_stipe_skin YFB_cap_tissue 0.095644 no
YFB_stipe_skin YFB_gill_tissue 0.198663 no
YFB_stipe_skin YFB_veil 0.244377 no
YFB_cap_skin YFB_cap_tissue 0.965513 no
YFB_cap_skin YFB_gill_tissue 0.899960 no
YFB_cap_skin YFB_veil 0.859320 no
YFB_cap_tissue YFB_gill_tissue 0.855184 no
YFB_cap_tissue YFB_veil 0.810684 no
YFB_gill_tissue YFB_veil 0.968401 no
Initials DIF_gill_tissue 0.977679 no
Initials YFB_stipe_center 0.765110 no
Initials YFB_stipe_shell 0.221819 no
Initials YFB_stipe_skin 0.215396 no
Initials YFB_cap_skin 0.887917 no
Initials YFB_cap_tissue 0.843944 no
Initials YFB_gill_tissue 0.989292 no
Initials YFB_veil 0.977033 no
Initials Pileal_Stipeal_center 0.566822 no
Initials Pileal_Stipeal_shell 0.890065 no
Initials DIF_stipe_center 0.450665 no
Initials DIF_stipe_shell 0.195682 no
Initials DIF_stipe_skin 0.277880 no
Initials DIF_cap_skin 0.983860 no
Initials DIF_cap_tissue 0.948641 no
Pileal_Stipeal_center DIF_gill_tissue 0.533228 no
Pileal_Stipeal_center YFB_stipe_center 0.863469 no
Pileal_Stipeal_center YFB_stipe_shell 0.702303 no
Pileal_Stipeal_center YFB_stipe_skin 0.697022 no
Pileal_Stipeal_center YFB_cap_skin 0.404208 no
Pileal_Stipeal_center YFB_cap_tissue 0.352768 no
Pileal_Stipeal_center YFB_gill_tissue 0.551685 no
Pileal_Stipeal_center YFB_veil 0.619792 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.410792 no
Pileal_Stipeal_center DIF_stipe_center 0.932469 no
Pileal_Stipeal_center DIF_stipe_shell 0.661774 no
Pileal_Stipeal_center DIF_stipe_skin 0.785863 no
Pileal_Stipeal_center DIF_cap_skin 0.544343 no
Pileal_Stipeal_center DIF_cap_tissue 0.664245 no
Pileal_Stipeal_shell DIF_gill_tissue 0.915114 no
Pileal_Stipeal_shell YFB_stipe_center 0.597521 no
Pileal_Stipeal_shell YFB_stipe_shell 0.128665 no
Pileal_Stipeal_shell YFB_stipe_skin 0.125875 no
Pileal_Stipeal_shell YFB_cap_skin 0.996834 no
Pileal_Stipeal_shell YFB_cap_tissue 0.961958 no
Pileal_Stipeal_shell YFB_gill_tissue 0.904295 no
Pileal_Stipeal_shell YFB_veil 0.864937 no
Pileal_Stipeal_shell DIF_stipe_center 0.296901 no
Pileal_Stipeal_shell DIF_stipe_shell 0.110080 no
Pileal_Stipeal_shell DIF_stipe_skin 0.164492 no
Pileal_Stipeal_shell DIF_cap_skin 0.909479 no
Pileal_Stipeal_shell DIF_cap_tissue 0.824726 no
DIF_stipe_center DIF_gill_tissue 0.419197 no
DIF_stipe_center YFB_stipe_center 0.761766 no
DIF_stipe_center YFB_stipe_shell 0.801735 no
DIF_stipe_center YFB_stipe_skin 0.798208 no
DIF_stipe_center YFB_cap_skin 0.304591 no
DIF_stipe_center YFB_cap_tissue 0.256965 no
DIF_stipe_center YFB_gill_tissue 0.435788 no
DIF_stipe_center YFB_veil 0.499736 no
DIF_stipe_center DIF_stipe_shell 0.766930 no
DIF_stipe_center DIF_stipe_skin 0.878244 no
DIF_stipe_center DIF_cap_skin 0.434185 no
DIF_stipe_center DIF_cap_tissue 0.546138 no
DIF_stipe_shell DIF_gill_tissue 0.177815 no
DIF_stipe_shell YFB_stipe_center 0.448703 no
DIF_stipe_shell YFB_stipe_shell 0.978374 no
DIF_stipe_shell YFB_stipe_skin 0.980135 no
DIF_stipe_shell YFB_cap_skin 0.117324 no
DIF_stipe_shell YFB_cap_tissue 0.089805 no
DIF_stipe_shell YFB_gill_tissue 0.184076 no
DIF_stipe_shell YFB_veil 0.231748 no
DIF_stipe_shell DIF_stipe_skin 0.913164 no
DIF_stipe_shell DIF_cap_skin 0.181205 no
DIF_stipe_shell DIF_cap_tissue 0.265454 no
DIF_stipe_skin DIF_gill_tissue 0.248439 no
DIF_stipe_skin YFB_stipe_center 0.568904 no
DIF_stipe_skin YFB_stipe_shell 0.938788 no
DIF_stipe_skin YFB_stipe_skin 0.936996 no
DIF_stipe_skin YFB_cap_skin 0.165288 no
DIF_stipe_skin YFB_cap_tissue 0.135006 no
DIF_stipe_skin YFB_gill_tissue 0.259163 no
DIF_stipe_skin YFB_veil 0.312117 no
DIF_stipe_skin DIF_cap_skin 0.256658 no
DIF_stipe_skin DIF_cap_tissue 0.359174 no
DIF_cap_skin DIF_gill_tissue 0.992827 no
DIF_cap_skin YFB_stipe_center 0.743856 no
DIF_cap_skin YFB_stipe_shell 0.201033 no
DIF_cap_skin YFB_stipe_skin 0.194366 no
DIF_cap_skin YFB_cap_skin 0.909397 no
DIF_cap_skin YFB_cap_tissue 0.865216 no
DIF_cap_skin YFB_gill_tissue 0.994029 no
DIF_cap_skin YFB_veil 0.963352 no
DIF_cap_skin DIF_cap_tissue 0.934190 no
DIF_cap_tissue DIF_gill_tissue 0.925187 no
DIF_cap_tissue YFB_stipe_center 0.843154 no
DIF_cap_tissue YFB_stipe_shell 0.292131 no
DIF_cap_tissue YFB_stipe_skin 0.284448 no
DIF_cap_tissue YFB_cap_skin 0.820640 no
DIF_cap_tissue YFB_cap_tissue 0.771042 no
DIF_cap_tissue YFB_gill_tissue 0.939658 no
DIF_cap_tissue YFB_veil 0.973017 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061130
MSVTRRLFGGAITANTAPDLLDASDFRQVPDNQEVFMYPHSIVSIIFEVLQAVDEQDDRKAARFHFDSVAHDNDA
ELSQVEEINVVPHERGDLTPSPIVLRGTQTVRKFNRKELDTIQILMALYRVKDRKADLVVTFNIPIESEDPGVAT
EVQVQRVIDDFKEVVKSLEIKDFNLFA*
Coding >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT
TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA
CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA
GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT
CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG
GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT
GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA
TTTGCGTGA
Transcript >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT
TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA
CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA
GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT
CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG
GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT
GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA
TTTGCGTGA
Gene >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCGTAT
GTCGATCTCGTTCCTGTAATACAGCCACTGCTCATCATAGGACGCTAGCGATTTCCGCCAGGTCCCAGATAATCA
AGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTACAAGCTGTAGATGAACAGGACGA
TAGAAAAGCCGCCAGGCATGTTTCATTGTATTCCAACAGTTTCAGCAGCTCTCAAATCACACGCTTTCTCAGATT
TCACTTTGATTCAGTTGCACACGATAACGATGCAGAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGA
GAGAGGTGATTTAACTCCATCTCCCATCGTACTTCGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACT
CGACACGATCCAAATCCTAATGGCGCTATATCGGGTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACAT
TCCTATCGAGTCAGAAGATCCAGGTGTAGCCACTGAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGT
TGTCAAATCCCTAGAGATCAAAGACTTTAATCTATTTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail