Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061130
Gene name
Locationscaffold_3:2034214..2034857
Strand-
Gene length (bp)643
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04603 Mog1 Ran-interacting Mog1 protein 5.7E-38 6 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 177 2.0E-20
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 7 177 4.0E-20
sp|Q9JIB0|MOG1_MOUSE Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 7 177 3.0E-19
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 5 176 1.0E-16
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 6 177 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 177 2.0E-20
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 7 177 4.0E-20
sp|Q9JIB0|MOG1_MOUSE Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 7 177 3.0E-19
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 5 176 1.0E-16
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 6 177 2.0E-14
sp|P47123|MOG1_YEAST Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 7 177 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061130
MSVTRRLFGGAITANTAPDLLDASDFRQVPDNQEVFMYPHSIVSIIFEVLQAVDEQDDRKAARFHFDSVAHDNDA
ELSQVEEINVVPHERGDLTPSPIVLRGTQTVRKFNRKELDTIQILMALYRVKDRKADLVVTFNIPIESEDPGVAT
EVQVQRVIDDFKEVVKSLEIKDFNLFA*
Coding >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT
TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA
CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA
GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT
CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG
GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT
GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA
TTTGCGTGA
Transcript >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCCGAT
TTCCGCCAGGTCCCAGATAATCAAGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTA
CAAGCTGTAGATGAACAGGACGATAGAAAAGCCGCCAGATTTCACTTTGATTCAGTTGCACACGATAACGATGCA
GAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGAGAGAGGTGATTTAACTCCATCTCCCATCGTACTT
CGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACTCGACACGATCCAAATCCTAATGGCGCTATATCGG
GTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACATTCCTATCGAGTCAGAAGATCCAGGTGTAGCCACT
GAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGTTGTCAAATCCCTAGAGATCAAAGACTTTAATCTA
TTTGCGTGA
Gene >AgabiH97|061130
ATGTCTGTTACTCGACGTCTTTTTGGCGGCGCCATTACCGCGAACACTGCCCCGGACCTGCTCGATGCATCGTAT
GTCGATCTCGTTCCTGTAATACAGCCACTGCTCATCATAGGACGCTAGCGATTTCCGCCAGGTCCCAGATAATCA
AGAAGTATTCATGTATCCGCACAGTATCGTCAGCATAATCTTTGAGGTCCTACAAGCTGTAGATGAACAGGACGA
TAGAAAAGCCGCCAGGCATGTTTCATTGTATTCCAACAGTTTCAGCAGCTCTCAAATCACACGCTTTCTCAGATT
TCACTTTGATTCAGTTGCACACGATAACGATGCAGAATTGTCTCAAGTGGAGGAGATTAACGTAGTGCCTCATGA
GAGAGGTGATTTAACTCCATCTCCCATCGTACTTCGCGGCACACAGACTGTGCGCAAATTCAACCGCAAGGAACT
CGACACGATCCAAATCCTAATGGCGCTATATCGGGTGAAGGATAGGAAGGCTGATTTAGTCGTGACTTTCAACAT
TCCTATCGAGTCAGAAGATCCAGGTGTAGCCACTGAGGTCCAAGTACAGAGAGTGATAGACGACTTCAAAGAGGT
TGTCAAATCCCTAGAGATCAAAGACTTTAATCTATTTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail