Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|061080
Gene name
Locationscaffold_3:2022956..2024795
Strand+
Gene length (bp)1839
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03291 Pox_MCEL mRNA capping enzyme 4.4E-90 199 509
PF13649 Methyltransf_25 Methyltransferase domain 2.8E-13 265 373
PF13847 Methyltransf_31 Methyltransferase domain 8.4E-11 261 393
PF08242 Methyltransf_12 Methyltransferase domain 5.3E-09 266 375
PF08241 Methyltransf_11 Methyltransferase domain 7.1E-09 266 376
PF13489 Methyltransf_23 Methyltransferase domain 7.1E-09 259 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO65|MCES_CRYNB mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ABD1 PE=3 SV=1 173 508 3.0E-101
sp|P0CO64|MCES_CRYNJ mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ABD1 PE=3 SV=1 173 508 5.0E-101
sp|O74880|MCES_SCHPO mRNA cap guanine-N7 methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm1 PE=1 SV=2 207 509 9.0E-86
sp|Q6CC11|MCES_YARLI mRNA cap guanine-N7 methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ABD1 PE=3 SV=1 207 508 6.0E-75
sp|Q28FT4|MCES_XENTR mRNA cap guanine-N7 methyltransferase OS=Xenopus tropicalis GN=rnmt PE=2 SV=1 183 509 2.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO65|MCES_CRYNB mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ABD1 PE=3 SV=1 173 508 3.0E-101
sp|P0CO64|MCES_CRYNJ mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ABD1 PE=3 SV=1 173 508 5.0E-101
sp|O74880|MCES_SCHPO mRNA cap guanine-N7 methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm1 PE=1 SV=2 207 509 9.0E-86
sp|Q6CC11|MCES_YARLI mRNA cap guanine-N7 methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ABD1 PE=3 SV=1 207 508 6.0E-75
sp|Q28FT4|MCES_XENTR mRNA cap guanine-N7 methyltransferase OS=Xenopus tropicalis GN=rnmt PE=2 SV=1 183 509 2.0E-69
sp|Q4R7K1|MCES_MACFA mRNA cap guanine-N7 methyltransferase OS=Macaca fascicularis GN=RNMT PE=2 SV=1 184 510 4.0E-67
sp|Q9I8S2|MCES_XENLA mRNA cap guanine-N7 methyltransferase OS=Xenopus laevis GN=rnmt PE=2 SV=1 183 509 4.0E-67
sp|Q5U2U7|MCES_RAT mRNA cap guanine-N7 methyltransferase OS=Rattus norvegicus GN=Rnmt PE=1 SV=1 199 510 8.0E-66
sp|O43148|MCES_HUMAN mRNA cap guanine-N7 methyltransferase OS=Homo sapiens GN=RNMT PE=1 SV=1 184 510 1.0E-65
sp|Q9D0L8|MCES_MOUSE mRNA cap guanine-N7 methyltransferase OS=Mus musculus GN=Rnmt PE=1 SV=1 181 510 2.0E-64
sp|Q1MTD3|MCES_DANRE mRNA cap guanine-N7 methyltransferase OS=Danio rerio GN=rnmt PE=3 SV=1 208 508 1.0E-63
sp|A4R8D7|MCES_MAGO7 mRNA cap guanine-N7 methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ABD1 PE=3 SV=1 180 508 4.0E-62
sp|Q6FML4|MCES_CANGA mRNA cap guanine-N7 methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ABD1 PE=3 SV=1 207 508 1.0E-60
sp|Q6Z9U7|MCES1_ORYSJ mRNA cap guanine-N7 methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os08g0180000 PE=2 SV=1 194 509 4.0E-60
sp|Q9LHQ7|MCES1_ARATH mRNA cap guanine-N7 methyltransferase 1 OS=Arabidopsis thaliana GN=At3g20650 PE=2 SV=1 208 509 2.0E-59
sp|A5DDJ4|MCES_PICGU mRNA cap guanine-N7 methyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ABD1 PE=3 SV=2 198 508 4.0E-56
sp|Q5ADX5|MCES_CANAL mRNA cap guanine-N7 methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ABD1 PE=3 SV=1 198 508 2.0E-55
sp|P32783|MCES_YEAST mRNA cap guanine-N7 methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABD1 PE=1 SV=1 197 508 5.0E-55
sp|A5E032|MCES_LODEL mRNA cap guanine-N7 methyltransferase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ABD1 PE=3 SV=1 207 508 6.0E-55
sp|A2QVS9|MCES_ASPNC mRNA cap guanine-N7 methyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abd1 PE=3 SV=1 203 506 6.0E-55
sp|A1CT57|MCES_ASPCL mRNA cap guanine-N7 methyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abd1 PE=3 SV=1 127 508 7.0E-55
sp|Q4WN42|MCES_ASPFU mRNA cap guanine-N7 methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abd1 PE=3 SV=1 198 508 8.0E-55
sp|Q6CKI0|MCES_KLULA mRNA cap guanine-N7 methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ABD1 PE=3 SV=1 207 508 1.0E-54
sp|A1DMG9|MCES_NEOFI mRNA cap guanine-N7 methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abd1 PE=3 SV=1 198 508 1.0E-54
sp|Q754U7|MCES_ASHGO mRNA cap guanine-N7 methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ABD1 PE=3 SV=1 207 508 3.0E-54
sp|Q9VJQ4|MCES_DROME mRNA cap guanine-N7 methyltransferase OS=Drosophila melanogaster GN=l(2)35Bd PE=1 SV=2 191 508 4.0E-54
sp|A3GEV2|MCES_PICST mRNA cap guanine-N7 methyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ABD1 PE=3 SV=1 207 508 3.0E-52
sp|Q6BMH4|MCES_DEBHA mRNA cap guanine-N7 methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ABD1 PE=3 SV=2 200 508 3.0E-52
sp|Q2UM19|MCES_ASPOR mRNA cap guanine-N7 methyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abd1 PE=3 SV=1 203 508 3.0E-52
sp|Q61E36|MCES_CAEBR mRNA cap guanine-N7 methyltransferase OS=Caenorhabditis briggsae GN=tag-72 PE=3 SV=1 208 510 4.0E-42
sp|Q9XVS1|MCES_CAEEL mRNA cap guanine-N7 methyltransferase OS=Caenorhabditis elegans GN=tag-72 PE=3 SV=2 208 436 8.0E-40
sp|Q8SR66|MCES_ENCCU mRNA cap guanine-N7 methyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ABD1 PE=1 SV=2 208 508 2.0E-38
sp|Q6K833|MCES2_ORYSJ mRNA cap guanine-N7 methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0780600 PE=2 SV=1 237 508 1.0E-17
sp|Q5HZ60|MCES2_ARATH mRNA cap guanine-N7 methyltransferase 2 OS=Arabidopsis thaliana GN=At3g52210 PE=2 SV=1 236 508 2.0E-15
sp|Q5UQX1|MCE_MIMIV Probable mRNA-capping enzyme OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R382 PE=1 SV=1 222 393 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|061080
MPAFDPVRDAVLNSPVEQSKSPFLAPRRQRSPASQSPSMARRATDLAMLLNADAAPPPHRPNPSTLSHILHDDDK
LAAAPPLRRSAQHFELPGSHFAYPPERSPSPGRLFPDSPRSRPSSSSSFAQPPPSTARNTSSPAHVPSTLPYNPT
KRITPPDSMLIPLSPVEMKMYRNFCGKGASRLLKRKRSASDEPEQPSAKRHAGDVGVVVDHYNSRPDVGVVQRGE
SPIIGLKNFNNWVKSVLITRFAHPVLAHSAYGQGRSKGKVLDMGCGKGGDLTKWAKARIKELLAVDIAAVSVDQA
RERWHTSKGHRFDASFAALDCYVESISRAFPPAKLAQPFDVVSMQFCMHYAFETIQKARCMLDNVSRFLRPGGVF
VGTIPNSDLLLKQLQSRQGKEPVFGNDVYTIRFEDPNHKGLFGHKYTFFLRDAVENVPEYVVVWDNFVQMAREYK
LDLLYRKPFHDVFVENQEDPELKALLFRMKVVDKDGKRTMDDAQWEATNIYIAFAFQKRQ*
Coding >AgabiH97|061080
ATGCCTGCGTTTGACCCTGTGCGCGATGCCGTGCTGAACTCGCCTGTCGAACAGTCCAAATCCCCCTTTCTGGCC
CCACGCAGACAGCGTTCGCCTGCAAGTCAGAGTCCGTCTATGGCTCGCAGAGCGACAGACCTCGCTATGCTTCTC
AACGCTGACGCTGCACCGCCGCCGCACAGACCCAATCCATCTACCCTTTCCCACATCCTCCACGATGACGACAAG
CTGGCTGCTGCCCCGCCCCTTCGTCGATCTGCACAACACTTTGAACTGCCCGGCTCTCACTTTGCATATCCACCA
GAACGTTCTCCCTCGCCCGGCCGTCTCTTTCCAGACTCCCCTCGCTCCAGACCCTCTTCCTCCTCCTCTTTTGCT
CAACCCCCACCCTCGACAGCACGCAACACTTCTTCGCCCGCTCATGTGCCATCCACTCTGCCCTATAATCCCACC
AAGCGTATAACTCCTCCCGACTCTATGTTAATTCCTCTTTCGCCAGTTGAAATGAAAATGTATAGGAATTTTTGC
GGGAAAGGAGCTTCACGGCTGCTCAAACGCAAACGTTCAGCAAGTGACGAGCCAGAACAGCCGTCAGCAAAGCGA
CATGCGGGTGATGTTGGTGTTGTCGTTGACCATTACAACTCGCGGCCAGACGTGGGTGTCGTGCAACGAGGCGAA
TCCCCCATCATCGGCCTCAAGAACTTCAATAACTGGGTCAAATCCGTCCTTATCACTCGGTTCGCTCATCCTGTT
TTAGCACATAGTGCATATGGCCAAGGACGGTCGAAAGGCAAAGTTTTGGATATGGGTTGTGGCAAGGGGGGTGAT
CTGACCAAGTGGGCCAAAGCTCGCATTAAAGAGCTGCTTGCCGTTGATATTGCTGCGGTATCAGTGGATCAAGCA
CGTGAACGTTGGCACACATCCAAAGGCCATAGATTCGATGCATCGTTCGCCGCTCTCGATTGTTATGTGGAATCG
ATATCGAGAGCATTTCCGCCTGCGAAATTAGCTCAACCTTTTGACGTCGTCTCTATGCAATTTTGCATGCATTAT
GCTTTTGAAACGATTCAAAAAGCGCGGTGTATGCTTGATAACGTCAGTCGATTCCTACGTCCTGGAGGTGTCTTC
GTCGGCACGATACCTAATTCAGATCTTCTACTAAAACAGCTACAGTCTCGGCAAGGCAAAGAACCGGTGTTTGGC
AATGATGTTTACACTATTCGATTCGAAGACCCGAATCACAAAGGTCTATTTGGCCATAAATATACCTTTTTCCTA
CGAGACGCTGTGGAAAACGTGCCTGAATATGTTGTCGTGTGGGATAACTTTGTTCAGATGGCGAGAGAATACAAA
CTCGATCTACTGTACAGGAAACCGTTTCACGACGTTTTTGTAGAGAATCAGGAGGATCCGGAGCTTAAGGCGCTA
TTGTTCAGGATGAAAGTTGTGGACAAGGACGGCAAGCGTACGATGGACGATGCTCAATGGGAGGCAACAAATATC
TATATTGCATTTGCGTTCCAAAAACGACAATGA
Transcript >AgabiH97|061080
ATGCCTGCGTTTGACCCTGTGCGCGATGCCGTGCTGAACTCGCCTGTCGAACAGTCCAAATCCCCCTTTCTGGCC
CCACGCAGACAGCGTTCGCCTGCAAGTCAGAGTCCGTCTATGGCTCGCAGAGCGACAGACCTCGCTATGCTTCTC
AACGCTGACGCTGCACCGCCGCCGCACAGACCCAATCCATCTACCCTTTCCCACATCCTCCACGATGACGACAAG
CTGGCTGCTGCCCCGCCCCTTCGTCGATCTGCACAACACTTTGAACTGCCCGGCTCTCACTTTGCATATCCACCA
GAACGTTCTCCCTCGCCCGGCCGTCTCTTTCCAGACTCCCCTCGCTCCAGACCCTCTTCCTCCTCCTCTTTTGCT
CAACCCCCACCCTCGACAGCACGCAACACTTCTTCGCCCGCTCATGTGCCATCCACTCTGCCCTATAATCCCACC
AAGCGTATAACTCCTCCCGACTCTATGTTAATTCCTCTTTCGCCAGTTGAAATGAAAATGTATAGGAATTTTTGC
GGGAAAGGAGCTTCACGGCTGCTCAAACGCAAACGTTCAGCAAGTGACGAGCCAGAACAGCCGTCAGCAAAGCGA
CATGCGGGTGATGTTGGTGTTGTCGTTGACCATTACAACTCGCGGCCAGACGTGGGTGTCGTGCAACGAGGCGAA
TCCCCCATCATCGGCCTCAAGAACTTCAATAACTGGGTCAAATCCGTCCTTATCACTCGGTTCGCTCATCCTGTT
TTAGCACATAGTGCATATGGCCAAGGACGGTCGAAAGGCAAAGTTTTGGATATGGGTTGTGGCAAGGGGGGTGAT
CTGACCAAGTGGGCCAAAGCTCGCATTAAAGAGCTGCTTGCCGTTGATATTGCTGCGGTATCAGTGGATCAAGCA
CGTGAACGTTGGCACACATCCAAAGGCCATAGATTCGATGCATCGTTCGCCGCTCTCGATTGTTATGTGGAATCG
ATATCGAGAGCATTTCCGCCTGCGAAATTAGCTCAACCTTTTGACGTCGTCTCTATGCAATTTTGCATGCATTAT
GCTTTTGAAACGATTCAAAAAGCGCGGTGTATGCTTGATAACGTCAGTCGATTCCTACGTCCTGGAGGTGTCTTC
GTCGGCACGATACCTAATTCAGATCTTCTACTAAAACAGCTACAGTCTCGGCAAGGCAAAGAACCGGTGTTTGGC
AATGATGTTTACACTATTCGATTCGAAGACCCGAATCACAAAGGTCTATTTGGCCATAAATATACCTTTTTCCTA
CGAGACGCTGTGGAAAACGTGCCTGAATATGTTGTCGTGTGGGATAACTTTGTTCAGATGGCGAGAGAATACAAA
CTCGATCTACTGTACAGGAAACCGTTTCACGACGTTTTTGTAGAGAATCAGGAGGATCCGGAGCTTAAGGCGCTA
TTGTTCAGGATGAAAGTTGTGGACAAGGACGGCAAGCGTACGATGGACGATGCTCAATGGGAGGCAACAAATATC
TATATTGCATTTGCGTTCCAAAAACGACAATGA
Gene >AgabiH97|061080
ATGCCTGCGTTTGACCCTGTGCGCGATGCCGTGCTGAACTCGCCTGTCGAACAGTCCAAATCCCCCTTTCTGGCC
CCACGCAGACAGCGTTCGCCTGCAAGTCAGAGTCCGTCTATGGCTCGCAGAGCGACAGACCTCGCTATGCTTCTC
AACGCTGACGCTGCACCGCCGCCGCACAGACCCAATCCATCTACCCTTTCCCACATCCTCCACGATGACGACAAG
CTGGCTGCTGCCCCGCCCCTTCGTCGATCTGCACAACACTTTGAACTGCCCGGCTCTCACTTTGCATATCCACCA
GAACGTTCTCCCTCGCCCGGCCGTCTCTTTCCAGACTCCCCTCGCTCCAGACCCTCTTCCTCCTCCTCTTTTGCT
CAACCCCCACCCTCGACAGCACGCAACACTTCTTCGCCCGCTCATGTGCCATCCACTCTGCCCTATAATCCCACC
AAGCGTATAACTCCTCCCGACTCTATGTTAATTCCTCTTTCGCCAGTTGAAATGAAAATGTATAGGAATTTTTGC
GGGAAAGGAGCTTCACGGCTGCTCAAACGCAAACGTTCAGCAAGTGACGAGCCAGAACAGCCGTCAGCAAAGCGA
CATGCGGGTGATGTTGGTGTTGTCGTTGACCATTGTACGTCATAACTTGTTCTTGCCGAGAGTCTAGAACTCAAA
CTGTGCTTCCCGACCAGACAACTCGCGGCCAGACGTGGGTGTCGTGCAACGAGGCGAATCCCCCATCATCGGCCT
CAAGAACTTCAATAACTGGGTCAAATCCGTCCTTATCACTCGGTTCGCTCATCCTGTTTTAGCACATAGTGCATA
TGGCCAAGGACGGTCGAAAGGCAAAGTTTTGGATATGGGTTGTGGCAAGGGGGGTGATCTGACCAAGTGGGCCAA
AGCTCGCATTAAAGAGCTGCTTGCCGTTGGTGCGTATCTTCTCAGCTCAGCTCTCCTCTCCTTTGTATTCATGGT
TCGCCTCGAAAAGATATTGCTGCGGTATCAGTGGATCAAGCACGTGAACGTTGGCACACATCCAAAGGCCATAGA
TTCGATGCATCGTTCGCCGCTCTCGATTGTTATGTGGAATCGATATCGAGAGCATTTCCGCCTGCGAAATTAGCT
CAACCTTTTGACGTCGTCTCTATGCAATTTTGCATGCATTATGCTTTTGAAACGATTCAAAAAGCGCGGTGTATG
CTTGATAACGTCAGTCGATTCCTACGTCCTGGAGGTGTCTTCGTCGGCACGATACCTAATTCAGATCTTCTACTG
TGTGTTCAATCTCTTTTTCTTCATGATTTATTGTCCTTTTGACTTGTGAGAACAGAAAACAGCTACAGTCTCGGC
AAGGCAAAGAACCGGTGTTTGGCAATGATGTTTACACTATTCGATTCGAAGACCCGAATCACAAAGGTCTATTTG
GCCATAAATATACCTTTTTCCTACGAGACGCTGTGGAAAACGTGCCTGAATATGTTGTCGTGTGGGATAACTTTG
TTCAGTCAGTCATTTCACCTCCGCAGTATGCGACGCAGCTAAACGTCATTCCATGCTCCCTTTTTGCGCTCTTAG
GATGGCGAGAGAATACAAACTCGATCTACTGTACAGGAAACCGTTTCACGACGTTTTTGTAGAGAATCAGGAGGA
TCCGGAGCTTAAGGCGCTATTGTTCAGGATGAAAGTTGTGGACAAGGACGGCAAGCGTACGATGGACGATGCTCA
ATGGGAGGCAACAAGTACGTCTCTATTGTTTTCCGTTCTTTTCCAACCATTTACAAACTTCGGACAAATTTTTAA
GATATCTATATTGCATTTGCGTTCCAAAAACGACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail