Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060860
Gene name
Locationscaffold_3:1970965..1972085
Strand+
Gene length (bp)1120
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 3.9E-16 74 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 5 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 2.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 4.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 6.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 5 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 2.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 4.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 6.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
sp|P14306|CPYI_YEAST Carboxypeptidase Y inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFS1 PE=1 SV=2 20 159 5.0E-08
sp|Q06252|YL179_YEAST Uncharacterized protein YLR179C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR179C PE=1 SV=1 28 203 6.0E-08
sp|P93003|TFL1_ARATH Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1 24 157 8.0E-07
sp|Q96S96|PEBP4_HUMAN Phosphatidylethanolamine-binding protein 4 OS=Homo sapiens GN=PEBP4 PE=1 SV=3 90 157 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 369.69 206.20 533.18
Initials Initials knots 178.12 106.06 250.18
Pileal_Stipeal_center Stage I stipe center 374.58 219.10 530.05
Pileal_Stipeal_shell Stage I stipe shell 396.09 224.73 567.46
DIF_stipe_center Stage II stipe center 416.45 240.93 591.97
DIF_stipe_shell Stage II stipe shell 302.75 179.37 426.13
DIF_stipe_skin Stage II stipe skin 335.75 196.64 474.85
DIF_cap_skin Stage II cap skin 504.06 286.11 722.02
DIF_cap_tissue Stage II cap tissue 467.40 268.05 666.75
DIF_gill_tissue Stage II gill tissue 451.27 259.28 643.26
YFB_stipe_center Young fruiting body stipe center 453.11 257.30 648.93
YFB_stipe_shell Young fruiting body stipe shell 358.87 210.06 507.68
YFB_stipe_skin Young fruiting body stipe skin 356.40 206.88 505.91
YFB_cap_skin Young fruiting body cap skin 428.96 247.93 609.99
YFB_cap_tissue Young fruiting body cap tissue 415.75 241.04 590.46
YFB_gill_tissue Young fruiting body gill tissue 367.89 212.90 522.87
YFB_veil Young fruiting body veil 387.41 223.96 550.86

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.624602 no
Casing YFB_stipe_center 0.620847 no
Casing YFB_stipe_shell 0.959699 no
Casing YFB_stipe_skin 0.950386 no
Casing YFB_cap_skin 0.742721 no
Casing YFB_cap_tissue 0.813016 no
Casing YFB_gill_tissue 0.992998 no
Casing YFB_veil 0.935199 no
Casing Initials 0.005671 yes
Casing Pileal_Stipeal_center 0.982058 no
Casing Pileal_Stipeal_shell 0.901721 no
Casing DIF_stipe_center 0.803499 no
Casing DIF_stipe_shell 0.612734 no
Casing DIF_stipe_skin 0.848127 no
Casing DIF_cap_skin 0.369371 no
Casing DIF_cap_tissue 0.534619 no
DIF_gill_tissue YFB_stipe_center 0.993849 no
DIF_gill_tissue YFB_stipe_shell 0.528877 no
DIF_gill_tissue YFB_stipe_skin 0.526001 no
DIF_gill_tissue YFB_cap_skin 0.925803 no
DIF_gill_tissue YFB_cap_tissue 0.873617 no
DIF_gill_tissue YFB_gill_tissue 0.598330 no
DIF_gill_tissue YFB_veil 0.724739 no
YFB_stipe_center YFB_stipe_shell 0.524212 no
YFB_stipe_center YFB_stipe_skin 0.520567 no
YFB_stipe_center YFB_cap_skin 0.921150 no
YFB_stipe_center YFB_cap_tissue 0.867943 no
YFB_stipe_center YFB_gill_tissue 0.593498 no
YFB_stipe_center YFB_veil 0.717176 no
YFB_stipe_shell YFB_stipe_skin 0.990904 no
YFB_stipe_shell YFB_cap_skin 0.664474 no
YFB_stipe_shell YFB_cap_tissue 0.743755 no
YFB_stipe_shell YFB_gill_tissue 0.965183 no
YFB_stipe_shell YFB_veil 0.883249 no
YFB_stipe_skin YFB_cap_skin 0.647939 no
YFB_stipe_skin YFB_cap_tissue 0.727960 no
YFB_stipe_skin YFB_gill_tissue 0.954012 no
YFB_stipe_skin YFB_veil 0.870568 no
YFB_cap_skin YFB_cap_tissue 0.955865 no
YFB_cap_skin YFB_gill_tissue 0.717934 no
YFB_cap_skin YFB_veil 0.832399 no
YFB_cap_tissue YFB_gill_tissue 0.786763 no
YFB_cap_tissue YFB_veil 0.892708 no
YFB_gill_tissue YFB_veil 0.925332 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.006742 yes
Initials YFB_stipe_skin 0.006032 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.004548 yes
Initials YFB_veil 0.002525 yes
Initials Pileal_Stipeal_center 0.003365 yes
Initials Pileal_Stipeal_shell 0.001140 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.048834 yes
Initials DIF_stipe_skin 0.011350 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.638725 no
Pileal_Stipeal_center YFB_stipe_center 0.635021 no
Pileal_Stipeal_center YFB_stipe_shell 0.937611 no
Pileal_Stipeal_center YFB_stipe_skin 0.926822 no
Pileal_Stipeal_center YFB_cap_skin 0.757507 no
Pileal_Stipeal_center YFB_cap_tissue 0.827521 no
Pileal_Stipeal_center YFB_gill_tissue 0.974124 no
Pileal_Stipeal_center YFB_veil 0.953073 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.917669 no
Pileal_Stipeal_center DIF_stipe_center 0.819598 no
Pileal_Stipeal_center DIF_stipe_shell 0.562185 no
Pileal_Stipeal_center DIF_stipe_skin 0.811592 no
Pileal_Stipeal_center DIF_cap_skin 0.379207 no
Pileal_Stipeal_center DIF_cap_tissue 0.546247 no
Pileal_Stipeal_shell DIF_gill_tissue 0.775464 no
Pileal_Stipeal_shell YFB_stipe_center 0.769938 no
Pileal_Stipeal_shell YFB_stipe_shell 0.841067 no
Pileal_Stipeal_shell YFB_stipe_skin 0.830042 no
Pileal_Stipeal_shell YFB_cap_skin 0.877923 no
Pileal_Stipeal_shell YFB_cap_tissue 0.931583 no
Pileal_Stipeal_shell YFB_gill_tissue 0.887268 no
Pileal_Stipeal_shell YFB_veil 0.970529 no
Pileal_Stipeal_shell DIF_stipe_center 0.927730 no
Pileal_Stipeal_shell DIF_stipe_shell 0.440546 no
Pileal_Stipeal_shell DIF_stipe_skin 0.693072 no
Pileal_Stipeal_shell DIF_cap_skin 0.518154 no
Pileal_Stipeal_shell DIF_cap_tissue 0.691081 no
DIF_stipe_center DIF_gill_tissue 0.874234 no
DIF_stipe_center YFB_stipe_center 0.868685 no
DIF_stipe_center YFB_stipe_shell 0.727140 no
DIF_stipe_center YFB_stipe_skin 0.720333 no
DIF_stipe_center YFB_cap_skin 0.958237 no
DIF_stipe_center YFB_cap_tissue 0.996937 no
DIF_stipe_center YFB_gill_tissue 0.784153 no
DIF_stipe_center YFB_veil 0.888882 no
DIF_stipe_center DIF_stipe_shell 0.328346 no
DIF_stipe_center DIF_stipe_skin 0.572275 no
DIF_stipe_center DIF_cap_skin 0.636669 no
DIF_stipe_center DIF_cap_tissue 0.800038 no
DIF_stipe_shell DIF_gill_tissue 0.184076 no
DIF_stipe_shell YFB_stipe_center 0.191340 no
DIF_stipe_shell YFB_stipe_shell 0.670818 no
DIF_stipe_shell YFB_stipe_skin 0.696205 no
DIF_stipe_shell YFB_cap_skin 0.270661 no
DIF_stipe_shell YFB_cap_tissue 0.332446 no
DIF_stipe_shell YFB_gill_tissue 0.614230 no
DIF_stipe_shell YFB_veil 0.489517 no
DIF_stipe_shell DIF_stipe_skin 0.824551 no
DIF_stipe_shell DIF_cap_skin 0.074840 no
DIF_stipe_shell DIF_cap_tissue 0.140421 no
DIF_stipe_skin DIF_gill_tissue 0.375672 no
DIF_stipe_skin YFB_stipe_center 0.376951 no
DIF_stipe_skin YFB_stipe_shell 0.898413 no
DIF_stipe_skin YFB_stipe_skin 0.911766 no
DIF_stipe_skin YFB_cap_skin 0.496484 no
DIF_stipe_skin YFB_cap_tissue 0.581299 no
DIF_stipe_skin YFB_gill_tissue 0.851753 no
DIF_stipe_skin YFB_veil 0.743755 no
DIF_stipe_skin DIF_cap_skin 0.185699 no
DIF_stipe_skin DIF_cap_tissue 0.298885 no
DIF_cap_skin DIF_gill_tissue 0.816867 no
DIF_cap_skin YFB_stipe_center 0.827262 no
DIF_cap_skin YFB_stipe_shell 0.292326 no
DIF_cap_skin YFB_stipe_skin 0.291857 no
DIF_cap_skin YFB_cap_skin 0.705609 no
DIF_cap_skin YFB_cap_tissue 0.636669 no
DIF_cap_skin YFB_gill_tissue 0.356545 no
DIF_cap_skin YFB_veil 0.466032 no
DIF_cap_skin DIF_cap_tissue 0.883204 no
DIF_cap_tissue DIF_gill_tissue 0.950483 no
DIF_cap_tissue YFB_stipe_center 0.956969 no
DIF_cap_tissue YFB_stipe_shell 0.440629 no
DIF_cap_tissue YFB_stipe_skin 0.438945 no
DIF_cap_tissue YFB_cap_skin 0.862364 no
DIF_cap_tissue YFB_cap_tissue 0.803199 no
DIF_cap_tissue YFB_gill_tissue 0.511427 no
DIF_cap_tissue YFB_veil 0.636040 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060860
MHSYLAIVSTFLALAAAQQNSDTNMGLAAIEAHFNQSHIVPDLLSAFQPQAVLGVNFGAGDIQPGQKFTIEEAGS
APTLTVNSSSPLNGSYVLAMIDADVPNSQLQKHNRHWLVGNVTIGQDSVVSNATATSYSRYFGPFPPSGSGPHRY
VIMLYAQPSDFNPPAEFATTDLPVEPMDWQAYVNDSHLGGLVAANYIQVEQGTASASIFSTAPVVSSTLVAASTT
AGSATTSSTQTGSSNESNGAKVLDFHVPAVMGLATLATLLLA*
Coding >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCACACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCCGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Transcript >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCACACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCCGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Gene >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGAGTTTCAGTGGTTTGAAGTGGAAATGCCTAGCTCAAATCTTGTTAAAGGT
GCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGGTGTGTTTCCCTTTCGCCCATGTTCGTCGCAGCGT
GTTCACTGTGTTGCTCTGTAGAGGCTGGCTCTGCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGT
CGTACGTGTTGGCCATGATAGACGCTGACGTGCCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTG
GCAATGTCACAATTGGCCAAGGTCAGTCGAAAAGCAAATGCCCTACTCACTCAAGTTTTTGCTCACATATCACAG
ACTCGGTGGTTAGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTC
CTCACCGGTCAGCGTGGTTGCCAGCTTGGGGGTTCAGGAATGCTAACGGCTCACCAACAGTTATGTCATAATGTT
ATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAACCAATGGACTG
GCAAGCATATGTCAACGTAAGGCCATCTTAACATCATATATCTCCTGAATCTCATATTTTGTGCAGGACTCACAC
CTTGGAGGTCTTGTGGCTGTAAGTAAGATATATCTCGAGTCTCGGCCACTTCACTGATTTTGTTCGACAGGCTAA
TTATATTCAGGTTGAACAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGT
TGCCGCTTCGACTACTGCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGC
CAAGGTCCTGGATTTCCACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail