Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060860
Gene name
Locationscaffold_3:1970965..1972085
Strand+
Gene length (bp)1120
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 3.9E-16 74 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 5 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 2.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 4.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 6.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 5 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 2.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 4.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 6.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
sp|P14306|CPYI_YEAST Carboxypeptidase Y inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFS1 PE=1 SV=2 20 159 5.0E-08
sp|Q06252|YL179_YEAST Uncharacterized protein YLR179C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR179C PE=1 SV=1 28 203 6.0E-08
sp|P93003|TFL1_ARATH Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1 24 157 8.0E-07
sp|Q96S96|PEBP4_HUMAN Phosphatidylethanolamine-binding protein 4 OS=Homo sapiens GN=PEBP4 PE=1 SV=3 90 157 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060860
MHSYLAIVSTFLALAAAQQNSDTNMGLAAIEAHFNQSHIVPDLLSAFQPQAVLGVNFGAGDIQPGQKFTIEEAGS
APTLTVNSSSPLNGSYVLAMIDADVPNSQLQKHNRHWLVGNVTIGQDSVVSNATATSYSRYFGPFPPSGSGPHRY
VIMLYAQPSDFNPPAEFATTDLPVEPMDWQAYVNDSHLGGLVAANYIQVEQGTASASIFSTAPVVSSTLVAASTT
AGSATTSSTQTGSSNESNGAKVLDFHVPAVMGLATLATLLLA*
Coding >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCACACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCCGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Transcript >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCACACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCCGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Gene >AgabiH97|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGAGTTTCAGTGGTTTGAAGTGGAAATGCCTAGCTCAAATCTTGTTAAAGGT
GCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGGTGTGTTTCCCTTTCGCCCATGTTCGTCGCAGCGT
GTTCACTGTGTTGCTCTGTAGAGGCTGGCTCTGCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGT
CGTACGTGTTGGCCATGATAGACGCTGACGTGCCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTG
GCAATGTCACAATTGGCCAAGGTCAGTCGAAAAGCAAATGCCCTACTCACTCAAGTTTTTGCTCACATATCACAG
ACTCGGTGGTTAGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTC
CTCACCGGTCAGCGTGGTTGCCAGCTTGGGGGTTCAGGAATGCTAACGGCTCACCAACAGTTATGTCATAATGTT
ATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAACCAATGGACTG
GCAAGCATATGTCAACGTAAGGCCATCTTAACATCATATATCTCCTGAATCTCATATTTTGTGCAGGACTCACAC
CTTGGAGGTCTTGTGGCTGTAAGTAAGATATATCTCGAGTCTCGGCCACTTCACTGATTTTGTTCGACAGGCTAA
TTATATTCAGGTTGAACAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGT
TGCCGCTTCGACTACTGCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGC
CAAGGTCCTGGATTTCCACGTCCCAGCTGTCATGGGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail