Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060820
Gene name
Locationscaffold_3:1953686..1954544
Strand-
Gene length (bp)858
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 6.4E-41 21 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 7 195 4.0E-77
sp|Q6DFS6|CHM2A_XENTR Charged multivesicular body protein 2a OS=Xenopus tropicalis GN=chmp2a PE=2 SV=1 4 188 4.0E-69
sp|Q7ZW25|CHM2A_DANRE Charged multivesicular body protein 2a OS=Danio rerio GN=chmp2a PE=2 SV=1 4 203 5.0E-69
sp|Q6IP52|CHM2A_XENLA Charged multivesicular body protein 2a OS=Xenopus laevis GN=chmp2a PE=2 SV=1 4 188 7.0E-69
sp|Q9DB34|CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus GN=Chmp2a PE=1 SV=1 7 195 5.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 7 195 4.0E-77
sp|Q6DFS6|CHM2A_XENTR Charged multivesicular body protein 2a OS=Xenopus tropicalis GN=chmp2a PE=2 SV=1 4 188 4.0E-69
sp|Q7ZW25|CHM2A_DANRE Charged multivesicular body protein 2a OS=Danio rerio GN=chmp2a PE=2 SV=1 4 203 5.0E-69
sp|Q6IP52|CHM2A_XENLA Charged multivesicular body protein 2a OS=Xenopus laevis GN=chmp2a PE=2 SV=1 4 188 7.0E-69
sp|Q9DB34|CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus GN=Chmp2a PE=1 SV=1 7 195 5.0E-66
sp|O43633|CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens GN=CHMP2A PE=1 SV=1 7 188 5.0E-66
sp|P36108|DID4_YEAST DOA4-independent degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DID4 PE=1 SV=2 1 213 1.0E-65
sp|Q5ZHN1|CHM2A_CHICK Charged multivesicular body protein 2a OS=Gallus gallus GN=CHMP2A PE=2 SV=1 7 187 2.0E-60
sp|Q9SKI2|VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana GN=VPS2.1 PE=1 SV=2 3 211 9.0E-60
sp|O14177|DID4_SCHPO ESCRT-III complex subunit did4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did4 PE=3 SV=2 1 193 2.0E-46
sp|Q941D5|VPS2C_ARATH Vacuolar protein sorting-associated protein 2 homolog 3 OS=Arabidopsis thaliana GN=VPS2.3 PE=2 SV=1 6 196 6.0E-42
sp|Q0WTY4|VPS2B_ARATH Vacuolar protein sorting-associated protein 2 homolog 2 OS=Arabidopsis thaliana GN=VPS2.2 PE=1 SV=2 6 189 3.0E-41
sp|Q7SYR0|CH2BA_XENLA Charged multivesicular body protein 2b-A OS=Xenopus laevis GN=chmp2b-a PE=2 SV=1 6 206 3.0E-34
sp|Q6NXD2|CHM2B_DANRE Charged multivesicular body protein 2b OS=Danio rerio GN=chmp2b PE=2 SV=1 6 189 8.0E-34
sp|Q66IV6|CH2BB_XENLA Charged multivesicular body protein 2b-B OS=Xenopus laevis GN=chmp2b-b PE=2 SV=1 6 206 1.0E-33
sp|Q5F3A2|CHM2B_CHICK Charged multivesicular body protein 2b OS=Gallus gallus GN=CHMP2B PE=2 SV=1 6 206 4.0E-33
sp|Q6NVL7|CHM2B_XENTR Charged multivesicular body protein 2b OS=Xenopus tropicalis GN=chmp2b PE=2 SV=1 6 206 3.0E-32
sp|Q5RAV2|CHM2B_PONAB Charged multivesicular body protein 2b OS=Pongo abelii GN=CHMP2B PE=2 SV=1 6 206 3.0E-31
sp|Q9UQN3|CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens GN=CHMP2B PE=1 SV=1 6 206 3.0E-31
sp|Q3SX42|CHM2B_BOVIN Charged multivesicular body protein 2b OS=Bos taurus GN=CHMP2B PE=2 SV=1 6 206 1.0E-30
sp|Q8BJF9|CHM2B_MOUSE Charged multivesicular body protein 2b OS=Mus musculus GN=Chmp2b PE=1 SV=1 6 206 1.0E-30
sp|Q54GK9|CM2A1_DICDI Charged multivesicular body protein 2a homolog 1 OS=Dictyostelium discoideum GN=chmp2a1 PE=3 SV=2 6 178 1.0E-27
sp|Q6NY88|CHMP3_DANRE Charged multivesicular body protein 3 OS=Danio rerio GN=chmp3 PE=2 SV=3 7 151 3.0E-15
sp|Q5BKM3|CHMP3_XENTR Charged multivesicular body protein 3 OS=Xenopus tropicalis GN=chmp3 PE=2 SV=4 7 171 6.0E-15
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 7 171 8.0E-15
sp|Q5RAU5|CHMP3_PONAB Charged multivesicular body protein 3 OS=Pongo abelii GN=CHMP3 PE=2 SV=3 7 193 2.0E-14
sp|Q58CS7|CHMP3_BOVIN Charged multivesicular body protein 3 OS=Bos taurus GN=CHMP3 PE=2 SV=4 7 193 2.0E-14
sp|Q9Y3E7|CHMP3_HUMAN Charged multivesicular body protein 3 OS=Homo sapiens GN=CHMP3 PE=1 SV=3 7 193 2.0E-14
sp|Q8CGS4|CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Chmp3 PE=1 SV=3 7 193 3.0E-14
sp|Q9CQ10|CHMP3_MOUSE Charged multivesicular body protein 3 OS=Mus musculus GN=Chmp3 PE=1 SV=3 7 193 3.0E-14
sp|Q4R574|CHMP3_MACFA Charged multivesicular body protein 3 OS=Macaca fascicularis GN=CHMP3 PE=2 SV=3 7 193 8.0E-14
sp|Q54P63|CHMP3_DICDI Charged multivesicular body protein 3 OS=Dictyostelium discoideum GN=chmp3 PE=3 SV=1 8 151 4.0E-13
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 7 168 5.0E-11
sp|Q9CQD4|CH1B2_MOUSE Charged multivesicular body protein 1b-2 OS=Mus musculus GN=Chmp1b2 PE=2 SV=2 18 194 9.0E-11
sp|Q5ZKX1|CHM1B_CHICK Charged multivesicular body protein 1b OS=Gallus gallus GN=CHMP1B PE=2 SV=1 18 200 1.0E-10
sp|Q99LU0|CH1B1_MOUSE Charged multivesicular body protein 1b-1 OS=Mus musculus GN=Chmp1b1 PE=1 SV=1 18 200 2.0E-10
sp|Q9FFB3|VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana GN=VPS24-1 PE=1 SV=1 14 154 3.0E-10
sp|Q7LBR1|CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens GN=CHMP1B PE=1 SV=1 18 200 3.0E-10
sp|Q7ZVB1|CHM1B_DANRE Charged multivesicular body protein 1b OS=Danio rerio GN=chmp1b PE=2 SV=1 18 200 4.0E-10
sp|P36095|VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS24 PE=1 SV=1 18 174 4.0E-10
sp|Q5E994|CHM1B_BOVIN Charged multivesicular body protein 1b OS=Bos taurus GN=CHMP1B PE=2 SV=1 18 200 5.0E-10
sp|Q7SZB5|CHM1B_XENLA Charged multivesicular body protein 1b OS=Xenopus laevis GN=chmp1b PE=2 SV=1 18 194 9.0E-10
sp|Q6DF27|CHM1B_XENTR Charged multivesicular body protein 1b OS=Xenopus tropicalis GN=chmp1b PE=2 SV=1 57 194 2.0E-08
sp|O96552|CHMP1_DICDI Charged multivesicular body protein 1 OS=Dictyostelium discoideum GN=chmp1 PE=3 SV=1 30 188 3.0E-08
sp|Q9LXH5|VP242_ARATH Putative vacuolar protein sorting-associated protein 24 homolog 2 OS=Arabidopsis thaliana GN=VPS24-2 PE=2 SV=1 39 179 1.0E-07
sp|Q6PHF0|CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio GN=chmp1a PE=2 SV=1 30 192 2.0E-07
sp|Q921W0|CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus GN=Chmp1a PE=1 SV=1 30 196 2.0E-07
sp|Q5R605|CHM1A_PONAB Charged multivesicular body protein 1a OS=Pongo abelii GN=CHMP1A PE=2 SV=1 30 196 2.0E-06
sp|Q9HD42|CHM1A_HUMAN Charged multivesicular body protein 1a OS=Homo sapiens GN=CHMP1A PE=1 SV=1 30 196 2.0E-06
sp|Q6NUD8|CHM1A_XENLA Charged multivesicular body protein 1a OS=Xenopus laevis GN=chmp1a PE=2 SV=1 48 196 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060820
MNLIESLFGRTVTPAERLRQHQRALAKAQRELDRERTKLEASEKKLVADIKRSAKSGQMNACKVMAKDLVRTRRY
VQKFYQMRTQLQAVGLRIQTLRSNQQMADAMRGATRAMASMNRGLNLPQIQRIMTDFEKESSMMDMKEEMMSDAV
DDVMDEEEDEEEEGDKILKQVLDEIGVDLSHQLTEAPTGIAAASKSLADRQPVALGEQGGASPRRPK*
Coding >AgabiH97|060820
ATGAACCTCATCGAATCCCTCTTTGGCCGCACAGTTACCCCCGCAGAGCGCCTTCGACAGCACCAGCGCGCCCTC
GCAAAGGCCCAGCGCGAGCTCGACCGCGAACGCACCAAGCTCGAGGCCAGCGAAAAGAAACTCGTCGCCGACATC
AAGAGGAGCGCAAAGTCGGGGCAAATGAATGCCTGCAAAGTCATGGCCAAAGATCTCGTCAGGACGCGTCGATAT
GTCCAGAAATTCTACCAGATGCGCACTCAGCTCCAGGCCGTCGGCCTACGAATACAGACCCTCCGAAGTAACCAG
CAAATGGCCGACGCCATGCGAGGTGCTACCCGGGCAATGGCCTCCATGAACCGCGGCCTCAATCTACCTCAAATT
CAGCGCATCATGACCGACTTTGAGAAAGAGAGCTCTATGATGGACATGAAAGAAGAGATGATGTCCGACGCTGTC
GACGATGTCATGGACGAGGAAGAAGATGAGGAGGAGGAAGGAGATAAGATCCTCAAACAGGTCCTCGACGAAATC
GGCGTCGATCTCTCCCATCAGCTTACGGAAGCCCCGACTGGTATCGCTGCGGCTTCCAAGTCTCTGGCAGATCGA
CAACCTGTCGCACTTGGGGAGCAGGGCGGAGCTTCGCCCCGCAGGCCCAAGTAA
Transcript >AgabiH97|060820
ATGAACCTCATCGAATCCCTCTTTGGCCGCACAGTTACCCCCGCAGAGCGCCTTCGACAGCACCAGCGCGCCCTC
GCAAAGGCCCAGCGCGAGCTCGACCGCGAACGCACCAAGCTCGAGGCCAGCGAAAAGAAACTCGTCGCCGACATC
AAGAGGAGCGCAAAGTCGGGGCAAATGAATGCCTGCAAAGTCATGGCCAAAGATCTCGTCAGGACGCGTCGATAT
GTCCAGAAATTCTACCAGATGCGCACTCAGCTCCAGGCCGTCGGCCTACGAATACAGACCCTCCGAAGTAACCAG
CAAATGGCCGACGCCATGCGAGGTGCTACCCGGGCAATGGCCTCCATGAACCGCGGCCTCAATCTACCTCAAATT
CAGCGCATCATGACCGACTTTGAGAAAGAGAGCTCTATGATGGACATGAAAGAAGAGATGATGTCCGACGCTGTC
GACGATGTCATGGACGAGGAAGAAGATGAGGAGGAGGAAGGAGATAAGATCCTCAAACAGGTCCTCGACGAAATC
GGCGTCGATCTCTCCCATCAGCTTACGGAAGCCCCGACTGGTATCGCTGCGGCTTCCAAGTCTCTGGCAGATCGA
CAACCTGTCGCACTTGGGGAGCAGGGCGGAGCTTCGCCCCGCAGGCCCAAGTAA
Gene >AgabiH97|060820
ATGAACCTCATCGCAAGTCCTCCTCCATCCCATCTCCACCCCTCTCACACCCCTCCCTAGGAATCCCTCTTTGGC
CGCACAGTTACCCCCGCAGAGCGCCTTCGACAGCACCAGCGCGCCCTCGCAAAGGCCCAGCGCGAGCTCGACCGC
GAACGCACCAAGCTCGAGGCCAGCGAAAAGAAACTCGTCGCCGACATCAAGAGGAGCGCAAAGTCGGGGCAAATG
GTCTGTGTTTTGTGTCTCCAACACTTCTTTCTCCCTTGTTCATCCAACCCCCAAGAATGCCTGCAAAGTCATGGC
CAAAGATCTCGTCAGGACGCGTCGATATGTCCAGAAATTCTACCAGATGCGCACTCAGCTCCAGGCCGTCGGCCT
ACGAATACAGACCCTCCGAAGTAACCAGCAAATGGCCGACGCCATGCGAGGTGCTACCCGGGTATGTACCTCCAC
CCTCCGCAGTCCTCTGTCACCCACCCCCATAGATAGGCAATGGCCTCCATGAACCGCGGCCTCAATCTACCTCAA
ATTCAGCGCATCATGACCGACTTTGAGAAAGAGAGCTCTATGATGGACATGAAAGAAGAGATGATGTCCGACGCT
GTCGACGATGTCATGGACGAGGAAGAAGATGAGGAGGAGGAAGGAGATAAGATCCTCAAACAGGTCCTCGACGAA
ATCGGCGTCGATCTCTCCCATCAGGTACGTCTCTCTACCGATTCTCCTTTGTTCTTTATCTCAATCTTCCTCCAG
CTTACGGAAGCCCCGACTGGTATCGCTGCGGCTTCCAAGTCTCTGGCAGATCGACAACCTGTCGCACTTGGGGAG
CAGGGCGGAGCTTCGCCCCGCAGGCCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail