Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060790
Gene name
Locationscaffold_3:1946457..1947153
Strand-
Gene length (bp)696
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10209 DUF2340 Uncharacterized conserved protein (DUF2340) 3.0E-52 19 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14037|YEY4_SCHPO UPF0538 protein C2C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.04c PE=3 SV=1 15 137 3.0E-37
sp|P36154|AIM29_YEAST Altered inheritance rate of mitochondria protein 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM29 PE=1 SV=1 4 137 5.0E-34
sp|Q54R16|U538_DICDI UPF0538 protein OS=Dictyostelium discoideum GN=DDB_G0283523 PE=3 SV=1 16 137 4.0E-25
sp|Q66IB8|CB076_DANRE UPF0538 protein C2orf76 homolog OS=Danio rerio GN=zgc:101851 PE=2 SV=1 17 137 8.0E-22
sp|Q9CRW3|CB076_MOUSE UPF0538 protein C2orf76 homolog OS=Mus musculus PE=1 SV=2 17 137 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14037|YEY4_SCHPO UPF0538 protein C2C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.04c PE=3 SV=1 15 137 3.0E-37
sp|P36154|AIM29_YEAST Altered inheritance rate of mitochondria protein 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM29 PE=1 SV=1 4 137 5.0E-34
sp|Q54R16|U538_DICDI UPF0538 protein OS=Dictyostelium discoideum GN=DDB_G0283523 PE=3 SV=1 16 137 4.0E-25
sp|Q66IB8|CB076_DANRE UPF0538 protein C2orf76 homolog OS=Danio rerio GN=zgc:101851 PE=2 SV=1 17 137 8.0E-22
sp|Q9CRW3|CB076_MOUSE UPF0538 protein C2orf76 homolog OS=Mus musculus PE=1 SV=2 17 137 1.0E-21
sp|A4IGN3|CB076_XENTR UPF0538 protein C2orf76 homolog OS=Xenopus tropicalis PE=2 SV=1 16 137 1.0E-19
sp|Q5RBS7|CB076_PONAB UPF0538 protein C2orf76 homolog OS=Pongo abelii PE=2 SV=1 17 137 3.0E-19
sp|Q3KRA6|CB076_HUMAN UPF0538 protein C2orf76 OS=Homo sapiens GN=C2orf76 PE=1 SV=3 17 137 6.0E-19
sp|Q32KX9|CB076_BOVIN UPF0538 protein C2orf76 homolog OS=Bos taurus PE=2 SV=1 17 137 3.0E-18
sp|Q6DJH5|CB076_XENLA UPF0538 protein C2orf76 homolog OS=Xenopus laevis PE=2 SV=1 16 137 5.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060790
MASESTTTNLALPKTSATLTIRIIKSFEFRTERSLVLHNVNLHTTTVGHLKKTALQAVETQPGWKPYRNVSLDTM
KLYTKAHGAKTSNLIINLDHDEWILNDDTCILADLGFENETEVSFFNRQAYDQFKLNPQTSWD*
Coding >AgabiH97|060790
ATGGCTTCCGAATCGACAACGACGAATCTCGCTCTGCCAAAAACGTCGGCAACACTCACCATTCGCATCATCAAG
TCTTTCGAATTCCGGACAGAGCGAAGCTTGGTTCTGCACAATGTCAATCTCCATACAACGACTGTCGGCCACCTG
AAAAAAACAGCTCTCCAAGCTGTAGAGACTCAGCCAGGCTGGAAGCCATATCGGAATGTCTCGCTGGATACAATG
AAGCTCTACACCAAGGCCCATGGAGCCAAGACTTCAAATTTGATCATCAATCTTGATCATGACGAATGGATACTC
AACGATGACACCTGTATTTTGGCCGATTTGGGATTCGAGAACGAAACAGAAGTCAGCTTTTTCAACCGCCAAGCC
TACGACCAATTCAAATTGAATCCTCAGACTAGCTGGGACTGA
Transcript >AgabiH97|060790
ATGGCTTCCGAATCGACAACGACGAATCTCGCTCTGCCAAAAACGTCGGCAACACTCACCATTCGCATCATCAAG
TCTTTCGAATTCCGGACAGAGCGAAGCTTGGTTCTGCACAATGTCAATCTCCATACAACGACTGTCGGCCACCTG
AAAAAAACAGCTCTCCAAGCTGTAGAGACTCAGCCAGGCTGGAAGCCATATCGGAATGTCTCGCTGGATACAATG
AAGCTCTACACCAAGGCCCATGGAGCCAAGACTTCAAATTTGATCATCAATCTTGATCATGACGAATGGATACTC
AACGATGACACCTGTATTTTGGCCGATTTGGGATTCGAGAACGAAACAGAAGTCAGCTTTTTCAACCGCCAAGCC
TACGACCAATTCAAATTGAATCCTCAGACTAGCTGGGACTGA
Gene >AgabiH97|060790
ATGGCTTCCGAATCGACAACGACGAATCTCGCTCTGCCAAAAACGTCGGCAACACTCACCATTCGCATCATCAAG
TCTTTCGAATTCCGGACAGAGCGAAGCTTGGTTCTGCACAATGTCAATCTCCATACAACGACTGTCGGCCACCTG
AAAAAAACAGCTCTCCAAGGTACTCGACCACGACAAATAAACTGAAGGCTTCCTTCCGACTATACCTCTTTCATC
GATTAGCTGTAGAGACTCAGCCAGGCTGGAAGCCATATCGGAATGTCTCGCTGGGTAGGCTACAATAATAGCTCT
GCCGTCCTCTGTCCCTCATTCTAGCTGCTCAGATACAATGAAGCTCTACACCAAGGCCCATGGAGCCAAGGTGAT
CTAAACCCTTCCCTTCGTGATTATTTTTGCCTCACCTGGCTGTTCAGACTTCAAATTTGATCATCAATCTTGATC
ATGACGAATGGATACTCAACGATGACACCTGTATTTTGGCCGATTTGGGATTCGGTGCGATCGCTTTCGTTCCTT
CCAGTGGACAGTTCCCAACAGCTGCGTTTCTTAGAGAACGAAACAGAAGTCAGCTTTTTCAACCGCCAAGCCTAC
GACCAATTCAAATTGAATCCTCAGGTAAGCAGCCCTTTCTCAGGTTTTCATGCGTATCAGATCCAAATACATGTA
TTGCAGACTAGCTGGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail