Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060780
Gene name
Locationscaffold_3:1944843..1946342
Strand+
Gene length (bp)1499
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01556 DnaJ_C DnaJ C terminal domain 7.6E-42 113 332
PF00226 DnaJ DnaJ domain 1.3E-21 6 64
PF00684 DnaJ_CXXCXGXG DnaJ central domain 2.1E-13 139 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74752|MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas5 PE=3 SV=1 1 405 6.0E-124
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 1 405 7.0E-121
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 2 405 2.0E-116
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 6 405 7.0E-114
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 1 402 5.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74752|MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas5 PE=3 SV=1 1 405 6.0E-124
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 1 405 7.0E-121
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 2 405 2.0E-116
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 6 405 7.0E-114
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 1 402 5.0E-112
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 1 402 6.0E-112
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 1 402 6.0E-112
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 1 402 1.0E-111
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 1 402 1.0E-111
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 2 405 4.0E-111
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 2 405 4.0E-111
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 2 405 8.0E-111
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 1 402 2.0E-110
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 1 402 2.0E-109
sp|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2 6 405 6.0E-107
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 1 402 9.0E-107
sp|P43644|DNJH_ATRNU DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1 6 405 4.0E-106
sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 6 405 1.0E-103
sp|Q03363|DNJH1_ALLPO DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1 16 405 6.0E-101
sp|Q94AW8|DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2 6 405 6.0E-97
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 1 387 2.0E-80
sp|O94657|XDJ1_SCHPO DnaJ protein homolog xdj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xdj1 PE=3 SV=1 1 365 5.0E-67
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 5 351 4.0E-54
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 4 345 8.0E-54
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 4 345 8.0E-54
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 4 345 2.0E-53
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 7 345 6.0E-53
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 1 345 2.0E-52
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 7 345 2.0E-52
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 4 345 2.0E-52
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 7 345 2.0E-52
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 1 353 2.0E-51
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 4 332 6.0E-51
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 7 345 7.0E-51
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 7 345 1.0E-50
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 4 357 4.0E-50
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 7 345 4.0E-50
sp|P53940|APJ1_YEAST J domain-containing protein APJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APJ1 PE=1 SV=1 8 380 4.0E-50
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 4 345 5.0E-50
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 4 345 5.0E-50
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 3 345 6.0E-50
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 3 345 8.0E-50
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 1 327 2.0E-49
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 4 336 2.0E-49
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 4 336 2.0E-49
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 4 345 2.0E-49
sp|Q8SRK0|MAS5_ENCCU Mitochondrial protein import protein mas5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=MAS5 PE=1 SV=1 7 358 2.0E-49
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 7 357 3.0E-49
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 3 345 4.0E-49
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 7 345 6.0E-49
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 4 357 9.0E-49
sp|Q044A8|DNAJ_LACGA Chaperone protein DnaJ OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaJ PE=3 SV=1 4 336 1.0E-48
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 3 345 1.0E-48
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 4 332 2.0E-48
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 4 332 2.0E-48
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 4 333 2.0E-48
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 7 360 2.0E-48
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 4 357 2.0E-48
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 7 360 3.0E-48
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 4 332 3.0E-48
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 4 334 4.0E-48
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 4 345 4.0E-48
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 7 345 4.0E-48
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 7 345 4.0E-48
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 1 332 4.0E-48
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 4 332 6.0E-48
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 4 345 6.0E-48
sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 4 345 9.0E-48
sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 4 345 9.0E-48
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 7 345 1.0E-47
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 7 345 1.0E-47
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 4 345 1.0E-47
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 7 345 1.0E-47
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 4 345 1.0E-47
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 7 333 1.0E-47
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 5 351 1.0E-47
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 4 345 2.0E-47
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 7 345 2.0E-47
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 7 345 2.0E-47
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 7 345 3.0E-47
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 7 345 3.0E-47
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 7 345 3.0E-47
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 4 332 3.0E-47
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 4 332 4.0E-47
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 4 332 4.0E-47
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 4 332 4.0E-47
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 4 332 4.0E-47
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 4 332 4.0E-47
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 7 345 4.0E-47
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 4 332 5.0E-47
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 4 332 5.0E-47
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 4 332 5.0E-47
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 4 332 5.0E-47
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 5 365 5.0E-47
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 1 345 5.0E-47
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 5 345 5.0E-47
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 7 345 6.0E-47
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 5 332 2.0E-46
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 1 337 2.0E-46
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 4 345 2.0E-46
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 1 337 3.0E-46
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 1 345 3.0E-46
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 7 329 3.0E-46
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 3 333 4.0E-46
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 4 345 4.0E-46
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 7 345 4.0E-46
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 7 332 4.0E-46
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 7 345 5.0E-46
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 7 345 5.0E-46
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 1 322 5.0E-46
sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 4 336 6.0E-46
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 1 345 6.0E-46
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 7 345 6.0E-46
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 7 345 7.0E-46
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 4 345 7.0E-46
sp|Q3IUB7|DNAJ_NATPD Chaperone protein DnaJ OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaJ PE=3 SV=1 7 344 9.0E-46
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 1 344 9.0E-46
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 1 345 1.0E-45
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 1 344 1.0E-45
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 4 345 1.0E-45
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 5 336 2.0E-45
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 4 345 2.0E-45
sp|O08356|DNAJ_RHOS7 Chaperone protein DnaJ OS=Rhodopseudomonas sp. (strain No.7) GN=dnaJ PE=3 SV=1 4 333 2.0E-45
sp|B3Q973|DNAJ_RHOPT Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaJ PE=3 SV=1 4 333 2.0E-45
sp|Q6NCY3|DNAJ_RHOPA Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaJ PE=3 SV=1 4 333 2.0E-45
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 5 345 2.0E-45
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 7 360 3.0E-45
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 1 364 3.0E-45
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 4 343 4.0E-45
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 1 364 5.0E-45
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 4 345 5.0E-45
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 4 345 6.0E-45
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 4 332 6.0E-45
sp|Q2J319|DNAJ_RHOP2 Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaJ PE=3 SV=1 4 333 6.0E-45
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 5 345 1.0E-44
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 5 345 1.0E-44
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 4 345 1.0E-44
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 4 345 1.0E-44
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 4 332 1.0E-44
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 4 333 1.0E-44
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 4 332 2.0E-44
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 4 345 2.0E-44
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 9 333 2.0E-44
sp|B4SSQ7|DNAJ_STRM5 Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaJ PE=3 SV=1 4 345 2.0E-44
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 4 332 3.0E-44
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 4 332 3.0E-44
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 1 345 3.0E-44
sp|Q4FVQ7|DNAJ_PSYA2 Chaperone protein DnaJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaJ PE=3 SV=1 4 345 3.0E-44
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 4 332 4.0E-44
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 4 345 4.0E-44
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 4 345 4.0E-44
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 7 345 4.0E-44
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 4 345 4.0E-44
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 4 345 4.0E-44
sp|Q8L3D3|DNAJ_COLMA Chaperone protein DnaJ OS=Colwellia maris GN=dnaJ PE=3 SV=2 4 345 4.0E-44
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 3 332 5.0E-44
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 4 345 5.0E-44
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 5 367 5.0E-44
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 4 345 6.0E-44
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 7 345 6.0E-44
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 7 345 6.0E-44
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 4 345 9.0E-44
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 4 345 9.0E-44
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 4 345 1.0E-43
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 4 345 1.0E-43
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 4 345 1.0E-43
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 4 345 1.0E-43
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 4 345 1.0E-43
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 4 345 2.0E-43
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 4 345 2.0E-43
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 4 345 2.0E-43
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 4 345 2.0E-43
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 4 345 2.0E-43
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 3 344 2.0E-43
sp|B8DQW8|DNAJ_DESVM Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaJ PE=3 SV=1 4 332 2.0E-43
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 4 345 3.0E-43
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 4 345 4.0E-43
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 4 345 5.0E-43
sp|Q7M9T3|DNAJ_WOLSU Chaperone protein DnaJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaJ PE=3 SV=1 4 378 5.0E-43
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 4 345 5.0E-43
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 4 345 5.0E-43
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 4 345 5.0E-43
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 4 332 5.0E-43
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 7 345 6.0E-43
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 4 345 6.0E-43
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 4 345 6.0E-43
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 4 345 6.0E-43
sp|B9KPP3|DNAJ_RHOSK Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dnaJ PE=3 SV=1 4 345 7.0E-43
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 4 345 7.0E-43
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 4 332 8.0E-43
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 4 332 8.0E-43
sp|A3PNM0|DNAJ_RHOS1 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaJ PE=3 SV=1 4 345 8.0E-43
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 5 345 9.0E-43
sp|Q3IYM8|DNAJ_RHOS4 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaJ PE=3 SV=1 4 345 9.0E-43
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 4 332 1.0E-42
sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 6 374 1.0E-42
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 4 335 1.0E-42
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 7 370 1.0E-42
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 3 345 1.0E-42
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 7 332 2.0E-42
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 4 345 2.0E-42
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 7 343 2.0E-42
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 4 332 2.0E-42
sp|Q1QET5|DNAJ_PSYCK Chaperone protein DnaJ OS=Psychrobacter cryohalolentis (strain K5) GN=dnaJ PE=3 SV=1 4 345 2.0E-42
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 4 343 2.0E-42
sp|Q93S23|DNAJ_RHITR Chaperone protein DnaJ (Fragment) OS=Rhizobium tropici GN=dnaJ PE=3 SV=1 25 345 2.0E-42
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 4 345 2.0E-42
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 7 365 2.0E-42
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 7 378 2.0E-42
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 4 332 2.0E-42
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 3 345 2.0E-42
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 4 345 3.0E-42
sp|A7IC67|DNAJ_XANP2 Chaperone protein DnaJ OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaJ PE=3 SV=1 4 345 3.0E-42
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 4 345 3.0E-42
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 4 345 4.0E-42
sp|A8EUC7|DNAJ_ARCB4 Chaperone protein DnaJ OS=Arcobacter butzleri (strain RM4018) GN=dnaJ PE=3 SV=1 4 378 4.0E-42
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 7 345 4.0E-42
sp|Q70WY6|DNAJ_FUSNP Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1 4 345 5.0E-42
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 7 345 5.0E-42
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 4 332 5.0E-42
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 4 344 6.0E-42
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 1 356 6.0E-42
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 4 332 7.0E-42
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 4 363 7.0E-42
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 4 345 8.0E-42
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 1 356 9.0E-42
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 4 345 9.0E-42
sp|A1B4F0|DNAJ_PARDP Chaperone protein DnaJ OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaJ PE=3 SV=1 4 345 1.0E-41
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 3 345 1.0E-41
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 4 345 1.0E-41
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 4 336 1.0E-41
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 4 345 1.0E-41
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 4 345 1.0E-41
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 4 345 2.0E-41
sp|Q8CXD3|DNAJ_OCEIH Chaperone protein DnaJ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaJ PE=3 SV=1 4 379 2.0E-41
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 5 366 2.0E-41
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 1 345 3.0E-41
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 1 345 3.0E-41
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 4 332 3.0E-41
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 4 332 3.0E-41
sp|A4WW88|DNAJ_RHOS5 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaJ PE=3 SV=1 4 345 3.0E-41
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 1 389 4.0E-41
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 4 345 4.0E-41
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 4 345 4.0E-41
sp|Q21CI1|DNAJ_RHOPB Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaJ PE=3 SV=1 4 333 4.0E-41
sp|P94319|DNAJ_BRADU Chaperone protein DnaJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaJ PE=3 SV=1 4 345 4.0E-41
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 4 345 4.0E-41
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 1 345 4.0E-41
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 5 333 5.0E-41
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 4 345 5.0E-41
sp|Q5M6D0|DNAJ_STRT2 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaJ PE=3 SV=1 6 346 6.0E-41
sp|Q5M1T7|DNAJ_STRT1 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaJ PE=3 SV=1 6 346 6.0E-41
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 4 332 7.0E-41
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 4 329 7.0E-41
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 4 345 7.0E-41
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 4 365 7.0E-41
sp|Q4FNQ0|DNAJ_PELUB Chaperone protein DnaJ OS=Pelagibacter ubique (strain HTCC1062) GN=dnaJ PE=3 SV=1 4 345 9.0E-41
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 4 332 1.0E-40
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 7 332 1.0E-40
sp|Q28VY4|DNAJ_JANSC Chaperone protein DnaJ OS=Jannaschia sp. (strain CCS1) GN=dnaJ PE=3 SV=1 4 345 1.0E-40
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 4 345 1.0E-40
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 4 345 1.0E-40
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 4 349 1.0E-40
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 4 345 1.0E-40
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 4 345 1.0E-40
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 5 333 1.0E-40
sp|Q8FNF5|DNAJ1_COREF Chaperone protein DnaJ 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaJ1 PE=3 SV=1 5 361 1.0E-40
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 4 345 2.0E-40
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 1 345 2.0E-40
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 4 332 2.0E-40
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 4 332 2.0E-40
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 4 332 2.0E-40
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 4 345 2.0E-40
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 4 345 2.0E-40
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 7 381 2.0E-40
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 4 345 3.0E-40
sp|B2GBQ6|DNAJ_LACF3 Chaperone protein DnaJ OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaJ PE=3 SV=1 4 336 3.0E-40
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 4 345 3.0E-40
sp|Q3K3T1|DNAJ_STRA1 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaJ PE=3 SV=1 6 337 3.0E-40
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 4 345 4.0E-40
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 4 345 4.0E-40
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 4 345 4.0E-40
sp|Q057X7|DNAJ_BUCCC Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dnaJ PE=3 SV=1 7 345 4.0E-40
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 4 345 4.0E-40
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 1 350 5.0E-40
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 4 345 5.0E-40
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 4 332 5.0E-40
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 4 332 5.0E-40
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 4 345 5.0E-40
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 4 332 5.0E-40
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 4 332 5.0E-40
sp|A8GMF8|DNAJ_RICAH Chaperone protein DnaJ OS=Rickettsia akari (strain Hartford) GN=dnaJ PE=3 SV=1 7 345 5.0E-40
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 3 345 5.0E-40
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 7 345 5.0E-40
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 7 345 5.0E-40
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 7 345 5.0E-40
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 7 345 5.0E-40
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 4 345 7.0E-40
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 4 345 7.0E-40
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 4 332 9.0E-40
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 4 350 9.0E-40
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 8 345 9.0E-40
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 4 345 9.0E-40
sp|C6BYN5|DNAJ_DESAD Chaperone protein DnaJ OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaJ PE=3 SV=1 4 353 1.0E-39
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 4 345 1.0E-39
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 4 345 1.0E-39
sp|Q6F150|DNAJ_MESFL Chaperone protein DnaJ OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaJ PE=3 SV=1 4 363 1.0E-39
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 4 345 1.0E-39
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 4 345 1.0E-39
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 4 345 1.0E-39
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 4 345 1.0E-39
sp|A5EYE5|DNAJ_DICNV Chaperone protein DnaJ OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaJ PE=3 SV=1 4 347 1.0E-39
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 4 336 1.0E-39
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 4 332 1.0E-39
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 7 343 1.0E-39
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 7 345 2.0E-39
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 7 345 2.0E-39
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 7 343 2.0E-39
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 4 332 2.0E-39
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 4 345 2.0E-39
sp|Q6AN63|DNAJ_DESPS Chaperone protein DnaJ OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaJ PE=3 SV=1 7 332 2.0E-39
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 5 348 2.0E-39
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 5 348 2.0E-39
sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 7 339 2.0E-39
sp|B0RVU1|DNAJ_XANCB Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaJ PE=3 SV=1 4 345 3.0E-39
sp|Q4KIH0|DNAJ_PSEF5 Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaJ PE=3 SV=1 4 345 3.0E-39
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 4 345 3.0E-39
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 5 348 3.0E-39
sp|Q84BU3|DNAJ_LACAC Chaperone protein DnaJ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaJ PE=3 SV=1 7 336 3.0E-39
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 7 345 3.0E-39
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 4 358 4.0E-39
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 4 358 4.0E-39
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 4 345 4.0E-39
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 5 345 4.0E-39
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 4 345 5.0E-39
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 4 345 5.0E-39
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 4 345 5.0E-39
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 6 363 6.0E-39
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 5 345 6.0E-39
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 1 332 6.0E-39
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 4 345 6.0E-39
sp|Q8PAK8|DNAJ_XANCP Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaJ PE=3 SV=1 4 345 8.0E-39
sp|Q4UT12|DNAJ_XANC8 Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaJ PE=3 SV=1 4 345 8.0E-39
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 4 345 8.0E-39
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 4 345 8.0E-39
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 4 380 8.0E-39
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 4 349 8.0E-39
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 4 345 9.0E-39
sp|Q8E298|DNAJ_STRA5 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaJ PE=3 SV=1 6 337 9.0E-39
sp|Q8E7Q7|DNAJ_STRA3 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaJ PE=3 SV=1 6 337 9.0E-39
sp|P35514|DNAJ_LACLA Chaperone protein DnaJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaJ PE=3 SV=2 6 344 1.0E-38
sp|C4Z1J3|DNAJ_EUBE2 Chaperone protein DnaJ OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaJ PE=3 SV=1 1 351 1.0E-38
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 4 332 1.0E-38
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 4 288 1.0E-38
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 4 332 1.0E-38
sp|A2RP20|DNAJ_LACLM Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dnaJ PE=3 SV=1 6 378 1.0E-38
sp|Q02VR5|DNAJ_LACLS Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dnaJ PE=3 SV=1 6 363 1.0E-38
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 4 345 2.0E-38
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 3 345 2.0E-38
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 4 332 2.0E-38
sp|Q16D44|DNAJ_ROSDO Chaperone protein DnaJ OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaJ PE=3 SV=1 4 332 2.0E-38
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 4 345 3.0E-38
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 4 345 3.0E-38
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 1 345 3.0E-38
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 1 322 3.0E-38
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 3 344 4.0E-38
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 4 332 4.0E-38
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 4 345 4.0E-38
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 5 348 5.0E-38
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 4 345 5.0E-38
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 4 332 6.0E-38
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 7 345 6.0E-38
sp|C8V213|MDJ1_EMENI DnaJ homolog 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10778 PE=3 SV=1 8 344 6.0E-38
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 3 371 6.0E-38
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 3 371 6.0E-38
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 4 332 7.0E-38
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 7 332 7.0E-38
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 7 332 8.0E-38
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 4 350 1.0E-37
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 7 348 1.0E-37
sp|Q5UXH9|DNAJ_HALMA Chaperone protein DnaJ OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaJ PE=3 SV=1 7 345 1.0E-37
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 7 336 1.0E-37
sp|Q5LWJ5|DNAJ_RUEPO Chaperone protein DnaJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaJ PE=3 SV=1 4 332 1.0E-37
sp|O69269|DNAJ_LYSSH Chaperone protein DnaJ OS=Lysinibacillus sphaericus GN=dnaJ PE=3 SV=1 4 345 1.0E-37
sp|Q6A997|DNAJ1_PROAC Chaperone protein DnaJ 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ1 PE=3 SV=1 7 351 1.0E-37
sp|Q7VG06|DNAJ_HELHP Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaJ PE=3 SV=1 7 345 2.0E-37
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 4 332 2.0E-37
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 7 345 2.0E-37
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 7 345 2.0E-37
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 4 345 2.0E-37
sp|Q7NDG8|DNAJ_GLOVI Chaperone protein DnaJ OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaJ PE=3 SV=1 5 350 3.0E-37
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 4 345 3.0E-37
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 4 345 3.0E-37
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 4 345 3.0E-37
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 4 345 3.0E-37
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 7 345 4.0E-37
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 7 345 4.0E-37
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 4 345 5.0E-37
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 4 332 5.0E-37
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 7 348 5.0E-37
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 7 348 6.0E-37
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 4 345 6.0E-37
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 4 332 7.0E-37
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 3 345 8.0E-37
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 7 358 8.0E-37
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 7 345 8.0E-37
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 4 332 9.0E-37
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 5 367 9.0E-37
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 4 388 9.0E-37
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 4 388 9.0E-37
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 3 333 9.0E-37
sp|Q92J37|DNAJ_RICCN Chaperone protein DnaJ OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaJ PE=3 SV=1 3 345 9.0E-37
sp|C3PMM6|DNAJ_RICAE Chaperone protein DnaJ OS=Rickettsia africae (strain ESF-5) GN=dnaJ PE=3 SV=1 3 345 9.0E-37
sp|Q73T77|DNAJ2_MYCPA Chaperone protein DnaJ 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ2 PE=3 SV=1 4 336 1.0E-36
sp|Q9KD71|DNAJ_BACHD Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaJ PE=3 SV=1 4 345 1.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0031072 heat shock protein binding Yes
GO:0051082 unfolded protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060780
MVFERKYYELLEVSPDASESDLKKAYRKRALKLHPDKGGDPELFKEVTHAYEILSDPQKRSIYDSRGEAGLSEQG
GMGGMDPQDLFSQLFGGAGGFFGGGNRPQGPRKTKDLVHRVHVTLEELYKGKTTKLALTRNILCSKCKGKGGKDG
AVRTCPGCHGRGVKVMMRHMGPMIQQIQTACDDCSGTGEFINTKDRCGNCKGKKVIPDKKMLEVHIDKGMKGGQT
VVFRGESDQAPSAEPGDVVIVIEEKPHERFRRQENDLILEVEIDLLTALAGGQFGIKHLDERALVVQVHPGEITK
HGDVKVIHGQGMPSQRHHEPGDLYVKVNVRFPELVDASAIPLLEQALPPREPLEDFGKDTTLDEVNLDAVDTRSK
NGFKSAAAAAAGDDAMDEDSEEPRVQCANQ*
Coding >AgabiH97|060780
ATGGTCTTCGAAAGAAAATACTATGAGCTCCTCGAGGTCAGCCCCGATGCCTCCGAATCCGACCTTAAAAAAGCC
TACCGCAAGAGGGCCCTCAAACTTCACCCAGACAAGGGTGGTGACCCCGAACTCTTCAAGGAGGTGACACATGCC
TATGAGATTCTCTCAGATCCCCAGAAGCGTTCGATTTACGATTCGCGCGGAGAAGCTGGTCTCTCCGAGCAGGGT
GGCATGGGTGGCATGGATCCTCAAGATCTTTTCAGCCAGCTCTTCGGTGGTGCCGGCGGCTTCTTCGGCGGCGGC
AATCGGCCACAGGGTCCACGCAAAACAAAAGACCTTGTCCATCGTGTCCACGTCACCCTTGAGGAGCTCTACAAG
GGCAAAACCACAAAGCTCGCACTAACACGTAATATCCTCTGCTCCAAGTGCAAGGGCAAGGGAGGAAAGGACGGT
GCCGTGCGGACGTGTCCAGGCTGCCATGGACGTGGTGTCAAGGTCATGATGCGTCACATGGGTCCTATGATTCAA
CAAATTCAGACTGCTTGCGATGACTGCTCCGGAACTGGTGAATTTATCAACACCAAAGATCGGTGTGGCAACTGC
AAGGGCAAGAAGGTCATCCCCGATAAAAAAATGTTGGAAGTTCACATCGACAAGGGAATGAAAGGCGGTCAAACT
GTCGTTTTCCGGGGCGAATCCGACCAGGCGCCCTCGGCAGAACCAGGAGACGTCGTCATCGTCATCGAAGAAAAA
CCTCATGAGCGGTTCCGTCGACAGGAGAATGATCTCATACTCGAGGTCGAAATCGATCTTCTAACTGCCCTTGCT
GGAGGTCAATTCGGCATCAAACACCTCGATGAACGAGCACTTGTTGTTCAAGTACATCCAGGGGAAATCACAAAG
CATGGTGACGTCAAGGTCATTCATGGTCAGGGTATGCCCTCGCAACGACACCATGAGCCTGGTGACTTGTATGTC
AAAGTCAACGTTAGATTCCCTGAATTGGTGGATGCCTCGGCGATTCCTCTACTTGAACAAGCCCTACCACCTCGT
GAACCCCTGGAAGACTTTGGAAAGGATACCACGCTGGATGAGGTCAATCTCGATGCTGTAGATACGCGGTCCAAG
AATGGATTTAAATCGGCCGCAGCGGCCGCGGCTGGGGATGATGCGATGGACGAGGATAGTGAGGAGCCTCGGGTA
CAATGTGCAAACCAATGA
Transcript >AgabiH97|060780
ATGGTCTTCGAAAGAAAATACTATGAGCTCCTCGAGGTCAGCCCCGATGCCTCCGAATCCGACCTTAAAAAAGCC
TACCGCAAGAGGGCCCTCAAACTTCACCCAGACAAGGGTGGTGACCCCGAACTCTTCAAGGAGGTGACACATGCC
TATGAGATTCTCTCAGATCCCCAGAAGCGTTCGATTTACGATTCGCGCGGAGAAGCTGGTCTCTCCGAGCAGGGT
GGCATGGGTGGCATGGATCCTCAAGATCTTTTCAGCCAGCTCTTCGGTGGTGCCGGCGGCTTCTTCGGCGGCGGC
AATCGGCCACAGGGTCCACGCAAAACAAAAGACCTTGTCCATCGTGTCCACGTCACCCTTGAGGAGCTCTACAAG
GGCAAAACCACAAAGCTCGCACTAACACGTAATATCCTCTGCTCCAAGTGCAAGGGCAAGGGAGGAAAGGACGGT
GCCGTGCGGACGTGTCCAGGCTGCCATGGACGTGGTGTCAAGGTCATGATGCGTCACATGGGTCCTATGATTCAA
CAAATTCAGACTGCTTGCGATGACTGCTCCGGAACTGGTGAATTTATCAACACCAAAGATCGGTGTGGCAACTGC
AAGGGCAAGAAGGTCATCCCCGATAAAAAAATGTTGGAAGTTCACATCGACAAGGGAATGAAAGGCGGTCAAACT
GTCGTTTTCCGGGGCGAATCCGACCAGGCGCCCTCGGCAGAACCAGGAGACGTCGTCATCGTCATCGAAGAAAAA
CCTCATGAGCGGTTCCGTCGACAGGAGAATGATCTCATACTCGAGGTCGAAATCGATCTTCTAACTGCCCTTGCT
GGAGGTCAATTCGGCATCAAACACCTCGATGAACGAGCACTTGTTGTTCAAGTACATCCAGGGGAAATCACAAAG
CATGGTGACGTCAAGGTCATTCATGGTCAGGGTATGCCCTCGCAACGACACCATGAGCCTGGTGACTTGTATGTC
AAAGTCAACGTTAGATTCCCTGAATTGGTGGATGCCTCGGCGATTCCTCTACTTGAACAAGCCCTACCACCTCGT
GAACCCCTGGAAGACTTTGGAAAGGATACCACGCTGGATGAGGTCAATCTCGATGCTGTAGATACGCGGTCCAAG
AATGGATTTAAATCGGCCGCAGCGGCCGCGGCTGGGGATGATGCGATGGACGAGGATAGTGAGGAGCCTCGGGTA
CAATGTGCAAACCAATGA
Gene >AgabiH97|060780
ATGGTCTTCGAAAGGTAGGCCGCCACTCGCCTCGTCGCCCGCTCTCCCCCTCACCCGTCTTCTCTTCCCAGAAAA
TACTATGAGCTCCTCGAGGTCAGCCCCGATGCCTCCGAATCCGACCTTAAAAAAGCCTACCGCAAGAGGTAGCTC
GTTTTCAGGTTTCTCGCTTTTTTCCTATTCTCATTCGTCTTCTAGGGCCCTCAAACTTCACCCAGACAAGGGTGG
TGACCCCGAACTCTTCAAGGAGGTGACACATGCGTATGTTCAGCTCTCTTGTCCCTGTTTTTTTCATGTCCTAAT
GCCCTGCCGATGCCAGCTATGAGATTCTCTCAGATCCCCAGAAGCGTTCGATTTACGATTCGCGCGGAGAAGCTG
GTCTCTCCGAGCAGGGTGGCATGGGTGGCATGGATCCTCAAGTCGGTCTACCTAGTCATCGATCATGTTCACTTT
TTTTACTGACTTTTTCTCCCCATAGGATCTTTTCAGCCAGCTCTTCGGTGGTGCCGGCGGCTTCTTCGGCGGCGG
CAATCGGCCACAGGGTCCACGCAAAACAAAAGACCTTGTCCATCGTGTCCACGTCACCCTTGAGGAGCTCTACAA
GGGCAAAACCACAAAGCTCGCACTAACACGTAATATCCTCTGCTCCAAGTGCAAGGGCAAGGGAGGAAAGGACGG
TGCCGTGCGGACGTGTCCAGGCTGCCATGGACGTGGTGTCAAGGTCATGATGCGTCACATGGGTCCTATGATTCA
ACAAATTCAGACTGCTTGCGATGACTGCTCCGGAACTGGTGAATTTATCAACACCAAAGATCGGTGTGGCAACTG
CAAGGGCAAGAAGGTCATCCCCGATAAAAAAATGTTGGAAGTTCACATCGACAAGGGAATGAAAGGCGGTCAAAC
TGTCGTTTTCCGGGGCGAATCCGACCAGGCGCCCTCGGCAGAACCAGGAGACGTCGTCATCGTCATCGAAGAAAA
ACCTCATGAGCGGTTCCGTCGACAGGAGAATGATCTCATACTCGAGGTCGAAATCGATCTTCTAACTGCCCTTGC
TGGAGGTCAATTCGGCATCAAACACCTCGATGAACGAGCACTTGTTGTTCAAGTACATCCAGGGGAAATCACAAA
GCATGGTGCGTATCTCTGAATTTCACATTTCGTCGCCTTCATGCTCACTGTCGCAATCAGGTGACGTCAAGGTCA
TTCATGGTCAGGGTATGCCCTCGCAACGACACCATGAGCCTGGTGACTTGTATGTCAAAGTCAACGTTAGATTCC
CTGAATTGGTGGATGCCTCGGCGATTCCTCTACTTGAACAAGCCCTACCACCTCGTGAACCCCTGGAAGACTTTG
GAAAGGATACCACGCTGGATGAGGTCAATCTCGATGCTGTAGATACGCGGTCCAAGAATGGATTTAAATCGGCCG
CAGCGGCCGCGGCTGGGGATGATGCGATGGACGAGGATAGTGAGGAGCCTCGGGTACAATGTGCAAACCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail