Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|060680
Gene name
Locationscaffold_3:1920532..1922876
Strand-
Gene length (bp)2344
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09423 PhoD PhoD-like phosphatase 1.2E-36 250 490

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|060680
MKIIAYLTAILGCLFRLACYVFLRVIPFTLAKYLLPPLYALHLLGLLLCTRKVNARAPNKEKSERETSAKLKSPT
HPKKTLFSRLYSILLCLPSPFHPLNWANLAVNTLLLAAAAESHLRKRRQNCGPISFSVCGGQLCPTANLSQHSDW
VATVKVENLLPDTQYEYILVDSNRTTLPYPSHPIRFSTFPDSRLAGGGVFRFLVSSCVTPNFPYRGPLHRKAIPG
FELLAQSLNLAPVSSSSQETQLGHARQSPVDFLLFLGDFIYADVPVYIGDKREAYRRLYRRNYQNVGFRSIYEHI
PIFHTYDDHEIINNYMGEENDLKPPYPNAADAFRLYNANANYGSIDDGQFYYDFRRGDTAFFVMDTRRYRSGLQD
PDFSTRSMLGEGQLTALLSWLSQVNHTAAFKFVVSSVPFTTLWLHDAQVDSWAGFPTERRLLLDAFHTVPNVIIL
SGDRHEFAAIAFNGDTPESHTVYEFSTSPLSMFYLPLIRTLVPKSQDNVTRARMEVHGSEIREYIEVLPKEEVLK
YLPIGNIKWSDIRVDTRNESQPLMYLNTFIDGRPSYNLTIKGSPLVKERPTAVEFSVTSTLRDMFCKFGLVPSQW
L*
Coding >AgabiH97|060680
ATGAAGATCATAGCGTATTTAACAGCCATTCTTGGCTGCTTGTTTCGACTAGCTTGCTACGTTTTTCTACGAGTC
ATTCCATTTACTCTTGCTAAATACCTGTTGCCTCCCCTTTACGCCTTGCATTTGCTAGGGCTGCTTTTATGCACG
AGAAAAGTAAATGCTCGTGCACCGAACAAGGAGAAATCTGAGCGCGAAACCAGTGCAAAGCTCAAATCACCAACA
CACCCAAAAAAAACACTGTTCAGCCGCCTCTATAGTATCCTTCTGTGTCTCCCTTCACCCTTTCATCCCCTCAAT
TGGGCAAACCTCGCCGTAAATACACTCTTGCTGGCGGCCGCTGCTGAGAGCCATTTACGCAAACGGCGCCAAAAT
TGTGGTCCGATATCCTTCTCCGTCTGTGGAGGACAGCTCTGTCCCACCGCCAATTTGAGCCAGCATTCGGACTGG
GTTGCCACTGTAAAAGTTGAGAATCTGCTGCCTGACACTCAATATGAATACATCCTGGTCGACAGTAATCGGACC
ACTCTTCCTTACCCTTCTCATCCCATTCGATTTTCTACTTTCCCTGACTCTCGTCTTGCTGGCGGAGGTGTCTTT
CGTTTCCTAGTTTCATCCTGCGTAACACCCAACTTTCCGTACCGTGGTCCTCTACATCGAAAGGCTATTCCCGGC
TTTGAACTTTTAGCTCAAAGCCTTAATTTAGCCCCCGTGTCCTCATCTTCTCAGGAAACACAACTAGGACATGCA
AGGCAATCTCCTGTTGACTTTCTCCTTTTTCTGGGGGATTTTATTTATGCGGATGTACCCGTCTATATCGGCGAC
AAGAGGGAAGCCTACAGGCGGTTATACAGGCGTAACTACCAAAATGTCGGATTTAGAAGTATCTACGAGCATATT
CCTATCTTCCATACTTATGACGATCACGAGATCATCAATAACTATATGGGTGAAGAAAACGATTTAAAGCCACCC
TACCCAAATGCAGCAGATGCATTCCGGCTATACAATGCAAACGCAAACTATGGCTCAATTGACGATGGTCAGTTT
TACTATGACTTTCGAAGAGGAGACACAGCCTTTTTTGTGATGGACACACGCCGATACCGATCTGGTCTTCAAGAT
CCCGATTTCTCAACCCGCTCAATGCTTGGAGAGGGACAATTAACGGCGCTGCTCTCATGGCTTTCGCAGGTCAAC
CATACGGCAGCTTTCAAATTTGTGGTTAGCTCTGTTCCATTCACCACTCTCTGGTTGCATGACGCACAGGTTGAC
TCATGGGCGGGATTTCCCACTGAGCGACGACTCTTGCTTGATGCTTTCCACACCGTACCTAATGTCATCATCCTC
TCTGGCGATCGTCATGAGTTTGCTGCTATTGCTTTCAACGGGGATACGCCCGAGTCCCACACGGTTTACGAGTTC
TCCACCAGTCCACTTAGTATGTTCTATTTGCCACTGATCCGCACTCTAGTACCCAAAAGTCAAGATAATGTAACG
AGGGCAAGGATGGAGGTGCACGGTTCTGAGATTAGAGAGTATATTGAGGTATTACCAAAGGAGGAGGTCCTCAAG
TATCTTCCCATTGGTAACATCAAGTGGTCGGACATACGAGTTGATACAAGAAATGAATCCCAGCCCCTCATGTAT
CTCAATACCTTCATTGATGGAAGGCCTTCATACAATTTGACTATAAAAGGCTCGCCGCTTGTAAAGGAACGTCCA
ACCGCCGTCGAATTTTCGGTTACGAGCACACTCAGAGACATGTTCTGTAAATTTGGACTTGTGCCTAGTCAATGG
CTATAG
Transcript >AgabiH97|060680
ATGAAGATCATAGCGTATTTAACAGCCATTCTTGGCTGCTTGTTTCGACTAGCTTGCTACGTTTTTCTACGAGTC
ATTCCATTTACTCTTGCTAAATACCTGTTGCCTCCCCTTTACGCCTTGCATTTGCTAGGGCTGCTTTTATGCACG
AGAAAAGTAAATGCTCGTGCACCGAACAAGGAGAAATCTGAGCGCGAAACCAGTGCAAAGCTCAAATCACCAACA
CACCCAAAAAAAACACTGTTCAGCCGCCTCTATAGTATCCTTCTGTGTCTCCCTTCACCCTTTCATCCCCTCAAT
TGGGCAAACCTCGCCGTAAATACACTCTTGCTGGCGGCCGCTGCTGAGAGCCATTTACGCAAACGGCGCCAAAAT
TGTGGTCCGATATCCTTCTCCGTCTGTGGAGGACAGCTCTGTCCCACCGCCAATTTGAGCCAGCATTCGGACTGG
GTTGCCACTGTAAAAGTTGAGAATCTGCTGCCTGACACTCAATATGAATACATCCTGGTCGACAGTAATCGGACC
ACTCTTCCTTACCCTTCTCATCCCATTCGATTTTCTACTTTCCCTGACTCTCGTCTTGCTGGCGGAGGTGTCTTT
CGTTTCCTAGTTTCATCCTGCGTAACACCCAACTTTCCGTACCGTGGTCCTCTACATCGAAAGGCTATTCCCGGC
TTTGAACTTTTAGCTCAAAGCCTTAATTTAGCCCCCGTGTCCTCATCTTCTCAGGAAACACAACTAGGACATGCA
AGGCAATCTCCTGTTGACTTTCTCCTTTTTCTGGGGGATTTTATTTATGCGGATGTACCCGTCTATATCGGCGAC
AAGAGGGAAGCCTACAGGCGGTTATACAGGCGTAACTACCAAAATGTCGGATTTAGAAGTATCTACGAGCATATT
CCTATCTTCCATACTTATGACGATCACGAGATCATCAATAACTATATGGGTGAAGAAAACGATTTAAAGCCACCC
TACCCAAATGCAGCAGATGCATTCCGGCTATACAATGCAAACGCAAACTATGGCTCAATTGACGATGGTCAGTTT
TACTATGACTTTCGAAGAGGAGACACAGCCTTTTTTGTGATGGACACACGCCGATACCGATCTGGTCTTCAAGAT
CCCGATTTCTCAACCCGCTCAATGCTTGGAGAGGGACAATTAACGGCGCTGCTCTCATGGCTTTCGCAGGTCAAC
CATACGGCAGCTTTCAAATTTGTGGTTAGCTCTGTTCCATTCACCACTCTCTGGTTGCATGACGCACAGGTTGAC
TCATGGGCGGGATTTCCCACTGAGCGACGACTCTTGCTTGATGCTTTCCACACCGTACCTAATGTCATCATCCTC
TCTGGCGATCGTCATGAGTTTGCTGCTATTGCTTTCAACGGGGATACGCCCGAGTCCCACACGGTTTACGAGTTC
TCCACCAGTCCACTTAGTATGTTCTATTTGCCACTGATCCGCACTCTAGTACCCAAAAGTCAAGATAATGTAACG
AGGGCAAGGATGGAGGTGCACGGTTCTGAGATTAGAGAGTATATTGAGGTATTACCAAAGGAGGAGGTCCTCAAG
TATCTTCCCATTGGTAACATCAAGTGGTCGGACATACGAGTTGATACAAGAAATGAATCCCAGCCCCTCATGTAT
CTCAATACCTTCATTGATGGAAGGCCTTCATACAATTTGACTATAAAAGGCTCGCCGCTTGTAAAGGAACGTCCA
ACCGCCGTCGAATTTTCGGTTACGAGCACACTCAGAGACATGTTCTGTAAATTTGGACTTGTGCCTAGTCAATGG
CTATAG
Gene >AgabiH97|060680
ATGAAGATCATAGCGTATTTAACAGCCATTCTTGGCTGCTTGTTTCGACTAGCTTGCTACGTTTTTCTACGAGTC
GTATGTCAACTTCTTTCCAGCTGCTTTCAACATACTGAAATAAATTACAGATTCCATTTACTCTTGCTAAATACC
TGTTGCCTCCCCTTTACGCCTTGCATTTGCTAGGGCTGCTTTTATGCACGAGAAAAGTAAATGCTCGTGCACCGA
ACAAGGAGAAATCTGAGCGCGAAACCAGTGCAAAGCTCAAATCACCAACAGTATGTCATTATAATTAGTAACAGA
ACGTGCAATGTCCTGCTAACCCCTGACATCAAGCACCCAAAAAAAACACTGTTCAGCCGCCTCTATAGTATCCTT
CTGTGTCTCCCTTCACCCTTTCATCCCCTCAATTGGGCAAACCTCGCCGTAAATACACTCTTGCTGGCGGCCGCT
GCTGAGTTTGCCATCACGCCCTTTTTTGATAAAGCCCAAAATGTCACATTTACCCGAGTAGGAGCCATTTACGCA
AACGGCGCCAAAATTGTGGTCCGATATCCTTCTCCGTCTGTGGAGGACAGCTCTGTGGATGTTCTCTGGCGTGAG
GTGTCAAATGGAACGCACTGGCAACAAGGTCCCACCGCCAATTTGAGCCAGCATTCGGACTGGGTTGCCACTGTA
AAAGTTGAGAATCTGCTGCCTGACACTCAATATGAATGTAAGCTTAGCACTCGCCTGTGTTGATATGAGTCTAAG
TAATATCACAGACATCCTGGTCGACAGTAATCGGACCACTCTTCCTTACCCTTCTCATCCCATTCGATTTTCTAC
TTTCCCTGACTCTCGTCTTGCTGGCGGAGGTGTCTTTCGTTTCCTAGTTTCATCCTGCGTAACACCCAACTTTCC
GTACCGTGGTCCTCTACATCGAAAGGCTATTCCCGGCTTTGAACTTTTAGCTCAAAGCCTTAATTTAGCCCCCGT
GTCCTCATCTTCTCAGGAAACACAACTAGGACATGCAAGGCAATCTCCTGTTGACTTTCTCCTTTTTCTGGGGGA
TTTTATTTATGCGGATGTACCCGTCTATATCGGCGACAAGAGGGAAGCCTACAGGCGGTTATACAGGCGTAACTA
CCAAAATGTCGGATTTAGAAGTATCTACGAGCATATTCGTAAGTCGTCATTCCCTAAGATATCGCTTATAATAGC
TCAGATCTCATATGCGACAGCTATCTTCCATACTTATGACGATCACGAGGTGGATATCTTTCATTTTAGTATCTG
GGTTGTCTTCAATGTTCATTTTATTCAGATCATCAATAACTATATGGGTGAAGAAAACGATTTAAAGCCACCCTA
CCCAAATGCAGCAGATGCATTCCGGCTATACAATGCAAACGCAAACTATGGCTCAATTGACGATGGTCAGTTTTA
CTATGACTTTCGAAGAGGAGACACAGCCTTTTTTGTGATGGACACACGCCGATACCGATCTGGTCTTCAAGATCC
CGATTTCTCAACCCGCTCAATGCTTGGAGAGGGACAATTAACGGCGCTGCTCTCATGGCTTTCGCAGGTAAGACG
TTTTCTACTGTCATACATGTCGAAATGGCTCATCTTCGCTTATCTTTTGCAGGTCAACCATACGGCAGCTTTCAA
ATTTGTGGTTAGCTCTGTTCCATTCACCACTCTCTGGTTGCATGACGCACAGGTTGACTCATGGGCGGGATTTCC
CACTGAGCGACGACTCTTGCTTGATGCTTTCCACACCGTACCTAATGTCATCATCCTCTCTGGCGATCGTCATGA
GTTTGCTGCTATTGCTTTCAACGGGGATACGCCCGAGTCCCACACGGTTTACGAGTTCTCCACCAGTCCACTTAG
TATGTTCTATTTGCCACTGATCCGCACTCTAGTACCCAAAAGTCAAGATAATGTAACGAGGGCAAGGATGGAGGT
GCACGGTTCTGAGATTAGAGAGTATATTGAGGTATTACCAAAGGAGGAGGTCCTCAAGTATCTTCCCATTGGTAA
CATCAAGTGGTGAGCTCGTGTTCAAATAACCCTATAATGGTCATTTGAGACGTCAAAACAGGTCGGACATACGAG
TTGATACAAGAAATGAATCCCAGCCCCTCATGTATCTCAATACCTTCATTGATGGAAGGCCTTCATACAAGTGTG
TACATAATGACCACATATCTGTTCCTTGATATTTAAATCACGTTTTAGTTTGACTATAAAAGGCTCGCCGCTTGT
AAAGGAACGTCCAACCGCCGTCGAATTTTCGGTTACGAGCACACTCAGAGACATGTTCTGTAAATTTGGACTTGT
GCCTAGTCAATGGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail