Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059850
Gene name
Locationscaffold_3:1726738..1727350
Strand+
Gene length (bp)612
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08284 RVP_2 Retroviral aspartyl protease 7.6E-10 34 132
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 1.1E-07 26 117
PF13650 Asp_protease_2 Aspartyl protease 5.8E-06 25 115

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 133 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 0.0 0.0 0.0
Initials Initials knots 0.0 0.0 0.0
Pileal_Stipeal_center Stage I stipe center 0.0 0.0 0.0
Pileal_Stipeal_shell Stage I stipe shell 0.0 0.0 0.0
DIF_stipe_center Stage II stipe center 0.0 0.0 0.0
DIF_stipe_shell Stage II stipe shell 0.0 0.0 0.0
DIF_stipe_skin Stage II stipe skin 0.0 0.0 0.0
DIF_cap_skin Stage II cap skin 0.0 0.0 0.0
DIF_cap_tissue Stage II cap tissue 0.0 0.0 0.0
DIF_gill_tissue Stage II gill tissue 0.0 0.0 0.0
YFB_stipe_center Young fruiting body stipe center 0.0 0.0 0.0
YFB_stipe_shell Young fruiting body stipe shell 0.0 0.0 0.0
YFB_stipe_skin Young fruiting body stipe skin 0.0 0.0 0.0
YFB_cap_skin Young fruiting body cap skin 0.0 0.0 0.0
YFB_cap_tissue Young fruiting body cap tissue 0.0 0.0 0.0
YFB_gill_tissue Young fruiting body gill tissue 0.0 0.0 0.0
YFB_veil Young fruiting body veil 0.0 0.0 0.0

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 1.0 no
Casing YFB_stipe_center 1.0 no
Casing YFB_stipe_shell 1.0 no
Casing YFB_stipe_skin 1.0 no
Casing YFB_cap_skin 1.0 no
Casing YFB_cap_tissue 1.0 no
Casing YFB_gill_tissue 1.0 no
Casing YFB_veil 1.0 no
Casing Initials 1.0 no
Casing Pileal_Stipeal_center 1.0 no
Casing Pileal_Stipeal_shell 1.0 no
Casing DIF_stipe_center 1.0 no
Casing DIF_stipe_shell 1.0 no
Casing DIF_stipe_skin 1.0 no
Casing DIF_cap_skin 1.0 no
Casing DIF_cap_tissue 1.0 no
DIF_gill_tissue YFB_stipe_center 1.0 no
DIF_gill_tissue YFB_stipe_shell 1.0 no
DIF_gill_tissue YFB_stipe_skin 1.0 no
DIF_gill_tissue YFB_cap_skin 1.0 no
DIF_gill_tissue YFB_cap_tissue 1.0 no
DIF_gill_tissue YFB_gill_tissue 1.0 no
DIF_gill_tissue YFB_veil 1.0 no
YFB_stipe_center YFB_stipe_shell 1.0 no
YFB_stipe_center YFB_stipe_skin 1.0 no
YFB_stipe_center YFB_cap_skin 1.0 no
YFB_stipe_center YFB_cap_tissue 1.0 no
YFB_stipe_center YFB_gill_tissue 1.0 no
YFB_stipe_center YFB_veil 1.0 no
YFB_stipe_shell YFB_stipe_skin 1.0 no
YFB_stipe_shell YFB_cap_skin 1.0 no
YFB_stipe_shell YFB_cap_tissue 1.0 no
YFB_stipe_shell YFB_gill_tissue 1.0 no
YFB_stipe_shell YFB_veil 1.0 no
YFB_stipe_skin YFB_cap_skin 1.0 no
YFB_stipe_skin YFB_cap_tissue 1.0 no
YFB_stipe_skin YFB_gill_tissue 1.0 no
YFB_stipe_skin YFB_veil 1.0 no
YFB_cap_skin YFB_cap_tissue 1.0 no
YFB_cap_skin YFB_gill_tissue 1.0 no
YFB_cap_skin YFB_veil 1.0 no
YFB_cap_tissue YFB_gill_tissue 1.0 no
YFB_cap_tissue YFB_veil 1.0 no
YFB_gill_tissue YFB_veil 1.0 no
Initials DIF_gill_tissue 1.0 no
Initials YFB_stipe_center 1.0 no
Initials YFB_stipe_shell 1.0 no
Initials YFB_stipe_skin 1.0 no
Initials YFB_cap_skin 1.0 no
Initials YFB_cap_tissue 1.0 no
Initials YFB_gill_tissue 1.0 no
Initials YFB_veil 1.0 no
Initials Pileal_Stipeal_center 1.0 no
Initials Pileal_Stipeal_shell 1.0 no
Initials DIF_stipe_center 1.0 no
Initials DIF_stipe_shell 1.0 no
Initials DIF_stipe_skin 1.0 no
Initials DIF_cap_skin 1.0 no
Initials DIF_cap_tissue 1.0 no
Pileal_Stipeal_center DIF_gill_tissue 1.0 no
Pileal_Stipeal_center YFB_stipe_center 1.0 no
Pileal_Stipeal_center YFB_stipe_shell 1.0 no
Pileal_Stipeal_center YFB_stipe_skin 1.0 no
Pileal_Stipeal_center YFB_cap_skin 1.0 no
Pileal_Stipeal_center YFB_cap_tissue 1.0 no
Pileal_Stipeal_center YFB_gill_tissue 1.0 no
Pileal_Stipeal_center YFB_veil 1.0 no
Pileal_Stipeal_center Pileal_Stipeal_shell 1.0 no
Pileal_Stipeal_center DIF_stipe_center 1.0 no
Pileal_Stipeal_center DIF_stipe_shell 1.0 no
Pileal_Stipeal_center DIF_stipe_skin 1.0 no
Pileal_Stipeal_center DIF_cap_skin 1.0 no
Pileal_Stipeal_center DIF_cap_tissue 1.0 no
Pileal_Stipeal_shell DIF_gill_tissue 1.0 no
Pileal_Stipeal_shell YFB_stipe_center 1.0 no
Pileal_Stipeal_shell YFB_stipe_shell 1.0 no
Pileal_Stipeal_shell YFB_stipe_skin 1.0 no
Pileal_Stipeal_shell YFB_cap_skin 1.0 no
Pileal_Stipeal_shell YFB_cap_tissue 1.0 no
Pileal_Stipeal_shell YFB_gill_tissue 1.0 no
Pileal_Stipeal_shell YFB_veil 1.0 no
Pileal_Stipeal_shell DIF_stipe_center 1.0 no
Pileal_Stipeal_shell DIF_stipe_shell 1.0 no
Pileal_Stipeal_shell DIF_stipe_skin 1.0 no
Pileal_Stipeal_shell DIF_cap_skin 1.0 no
Pileal_Stipeal_shell DIF_cap_tissue 1.0 no
DIF_stipe_center DIF_gill_tissue 1.0 no
DIF_stipe_center YFB_stipe_center 1.0 no
DIF_stipe_center YFB_stipe_shell 1.0 no
DIF_stipe_center YFB_stipe_skin 1.0 no
DIF_stipe_center YFB_cap_skin 1.0 no
DIF_stipe_center YFB_cap_tissue 1.0 no
DIF_stipe_center YFB_gill_tissue 1.0 no
DIF_stipe_center YFB_veil 1.0 no
DIF_stipe_center DIF_stipe_shell 1.0 no
DIF_stipe_center DIF_stipe_skin 1.0 no
DIF_stipe_center DIF_cap_skin 1.0 no
DIF_stipe_center DIF_cap_tissue 1.0 no
DIF_stipe_shell DIF_gill_tissue 1.0 no
DIF_stipe_shell YFB_stipe_center 1.0 no
DIF_stipe_shell YFB_stipe_shell 1.0 no
DIF_stipe_shell YFB_stipe_skin 1.0 no
DIF_stipe_shell YFB_cap_skin 1.0 no
DIF_stipe_shell YFB_cap_tissue 1.0 no
DIF_stipe_shell YFB_gill_tissue 1.0 no
DIF_stipe_shell YFB_veil 1.0 no
DIF_stipe_shell DIF_stipe_skin 1.0 no
DIF_stipe_shell DIF_cap_skin 1.0 no
DIF_stipe_shell DIF_cap_tissue 1.0 no
DIF_stipe_skin DIF_gill_tissue 1.0 no
DIF_stipe_skin YFB_stipe_center 1.0 no
DIF_stipe_skin YFB_stipe_shell 1.0 no
DIF_stipe_skin YFB_stipe_skin 1.0 no
DIF_stipe_skin YFB_cap_skin 1.0 no
DIF_stipe_skin YFB_cap_tissue 1.0 no
DIF_stipe_skin YFB_gill_tissue 1.0 no
DIF_stipe_skin YFB_veil 1.0 no
DIF_stipe_skin DIF_cap_skin 1.0 no
DIF_stipe_skin DIF_cap_tissue 1.0 no
DIF_cap_skin DIF_gill_tissue 1.0 no
DIF_cap_skin YFB_stipe_center 1.0 no
DIF_cap_skin YFB_stipe_shell 1.0 no
DIF_cap_skin YFB_stipe_skin 1.0 no
DIF_cap_skin YFB_cap_skin 1.0 no
DIF_cap_skin YFB_cap_tissue 1.0 no
DIF_cap_skin YFB_gill_tissue 1.0 no
DIF_cap_skin YFB_veil 1.0 no
DIF_cap_skin DIF_cap_tissue 1.0 no
DIF_cap_tissue DIF_gill_tissue 1.0 no
DIF_cap_tissue YFB_stipe_center 1.0 no
DIF_cap_tissue YFB_stipe_shell 1.0 no
DIF_cap_tissue YFB_stipe_skin 1.0 no
DIF_cap_tissue YFB_cap_skin 1.0 no
DIF_cap_tissue YFB_cap_tissue 1.0 no
DIF_cap_tissue YFB_gill_tissue 1.0 no
DIF_cap_tissue YFB_veil 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059850
MNNRYIVPQKRLGVQELEVKPLLTTTNGKKLKVSAMVNSGCTHTCIDEGLVKKKKIPTKKLERPITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGIIKFNRCPTSCSFPHTDISFEP
RIRRLQSNEDPEEKEPDPTNPEDLPAYMKPFAHLFNRTSQKTHQWRYHQRFIA*
Coding >AgabiH97|059850
ATGAACAATCGATACATTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCAACTCGGGATGCACACACACATGTATTGACGAAGGACTA
GTAAAGAAGAAGAAGATCCCAACGAAGAAACTGGAACGGCCGATCACATGCAGAAATTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAATGAGCAACTAGACGCAGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACCCGGAGGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAACTTCACAGAAAACGCACCAATGGAGATATCATCAAAGG
TTTATAGCATGA
Transcript >AgabiH97|059850
ATGAACAATCGATACATTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCAACTCGGGATGCACACACACATGTATTGACGAAGGACTA
GTAAAGAAGAAGAAGATCCCAACGAAGAAACTGGAACGGCCGATCACATGCAGAAATTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAATGAGCAACTAGACGCAGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACCCGGAGGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAACTTCACAGAAAACGCACCAATGGAGATATCATCAAAGG
TTTATAGCATGA
Gene >AgabiH97|059850
ATGAACAATCGATACATTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCAACTCGGGATGCACACACACATGTATTGACGAAGGACTA
GTAAAGAAGAAGAAGATCCCAACGAAGAAACTGGAACGGCCGATCACATGCAGAAATTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAATGAGCAACTAGACGCAGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACCCGGAGGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAACTTCACAGAAAACGCACCAATGGAGATATCATCAAAGG
TTTATAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail