Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059670
Gene name
Locationscaffold_3:1685516..1686581
Strand-
Gene length (bp)1065
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 6.0E-14 52 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P791|YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.12 PE=3 SV=1 5 199 3.0E-49
sp|Q01976|ADPP_YEAST ADP-ribose pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSA1 PE=1 SV=2 17 207 2.0E-44
sp|Q9UKK9|NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens GN=NUDT5 PE=1 SV=1 17 203 3.0E-34
sp|Q6AY63|NUDT5_RAT ADP-sugar pyrophosphatase OS=Rattus norvegicus GN=Nudt5 PE=2 SV=1 17 203 9.0E-32
sp|Q9JKX6|NUDT5_MOUSE ADP-sugar pyrophosphatase OS=Mus musculus GN=Nudt5 PE=1 SV=1 6 173 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P791|YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.12 PE=3 SV=1 5 199 3.0E-49
sp|Q01976|ADPP_YEAST ADP-ribose pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSA1 PE=1 SV=2 17 207 2.0E-44
sp|Q9UKK9|NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens GN=NUDT5 PE=1 SV=1 17 203 3.0E-34
sp|Q6AY63|NUDT5_RAT ADP-sugar pyrophosphatase OS=Rattus norvegicus GN=Nudt5 PE=2 SV=1 17 203 9.0E-32
sp|Q9JKX6|NUDT5_MOUSE ADP-sugar pyrophosphatase OS=Mus musculus GN=Nudt5 PE=1 SV=1 6 173 1.0E-31
sp|Q5RCY2|NUDT5_PONAB ADP-sugar pyrophosphatase OS=Pongo abelii GN=NUDT5 PE=2 SV=1 17 203 2.0E-31
sp|O61902|NDX2_CAEEL Putative nudix hydrolase 2 OS=Caenorhabditis elegans GN=ndx-2 PE=3 SV=1 17 202 1.0E-21
sp|P54570|ADPP_BACSU ADP-ribose pyrophosphatase OS=Bacillus subtilis (strain 168) GN=nudF PE=1 SV=1 40 172 3.0E-13
sp|Q8KP10|ACT_BACMT Methanol dehydrogenase activator OS=Bacillus methanolicus GN=act PE=1 SV=1 53 191 8.0E-10
sp|Q9SZ63|NUD14_ARATH Nudix hydrolase 14, chloroplastic OS=Arabidopsis thaliana GN=NUDT14 PE=1 SV=2 53 174 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059670
MTSVPKIISTTELSAQDAKWITLQKIKYSDAEGKERLWECAERKTRKSSGVDAVSVLALIDSKTNAFPLSTVIIE
QFRPPVGKFVVELPAGLIDEGESPETAAVRELEEETGFKAYSIFESSDIVVSDPGMTSANMKLVIANVLLDDKLE
LPEQKLEAGAGEFIKCRVVDLDKLHDELKEYARKGFIVDARLSHLATGFTLAQQFRIGLA*
Coding >AgabiH97|059670
ATGACATCGGTTCCAAAGATCATATCAACCACAGAGCTCTCTGCTCAGGATGCAAAATGGATTACTCTCCAGAAG
ATTAAATACTCTGACGCCGAAGGAAAAGAAAGATTGTGGGAGTGTGCTGAGCGCAAGACACGCAAATCTTCCGGC
GTCGATGCTGTATCTGTACTGGCTCTCATCGATTCGAAAACGAACGCATTCCCCTTGTCCACCGTAATCATTGAG
CAATTCAGGCCTCCCGTTGGAAAATTTGTCGTCGAACTTCCCGCAGGACTGATTGACGAAGGAGAATCTCCCGAG
ACTGCAGCAGTGAGGGAGTTGGAAGAAGAAACTGGTTTCAAAGCGTACAGTATCTTCGAAAGTTCGGATATTGTC
GTCAGCGATCCTGGGATGACGAGTGCCAATATGAAACTCGTAATTGCCAATGTATTGCTCGATGACAAGCTAGAG
TTGCCTGAACAAAAGCTGGAAGCTGGAGCTGGAGAATTTATAAAATGTCGTGTTGTTGATTTAGACAAATTGCAC
GATGAACTTAAAGAATATGCTAGAAAGGGCTTTATTGTTGACGCCAGGCTATCTCATCTTGCCACTGGCTTCACA
TTAGCACAGCAGTTCCGGATTGGATTGGCGTAA
Transcript >AgabiH97|059670
ATGACATCGGTTCCAAAGATCATATCAACCACAGAGCTCTCTGCTCAGGATGCAAAATGGATTACTCTCCAGAAG
ATTAAATACTCTGACGCCGAAGGAAAAGAAAGATTGTGGGAGTGTGCTGAGCGCAAGACACGCAAATCTTCCGGC
GTCGATGCTGTATCTGTACTGGCTCTCATCGATTCGAAAACGAACGCATTCCCCTTGTCCACCGTAATCATTGAG
CAATTCAGGCCTCCCGTTGGAAAATTTGTCGTCGAACTTCCCGCAGGACTGATTGACGAAGGAGAATCTCCCGAG
ACTGCAGCAGTGAGGGAGTTGGAAGAAGAAACTGGTTTCAAAGCGTACAGTATCTTCGAAAGTTCGGATATTGTC
GTCAGCGATCCTGGGATGACGAGTGCCAATATGAAACTCGTAATTGCCAATGTATTGCTCGATGACAAGCTAGAG
TTGCCTGAACAAAAGCTGGAAGCTGGAGCTGGAGAATTTATAAAATGTCGTGTTGTTGATTTAGACAAATTGCAC
GATGAACTTAAAGAATATGCTAGAAAGGGCTTTATTGTTGACGCCAGGCTATCTCATCTTGCCACTGGCTTCACA
TTAGCACAGCAGTTCCGGATTGGATTGGCGTAA
Gene >AgabiH97|059670
ATGACATCGGTTCCAAAGATCATATCAACCACAGAGCTCTCTGCTCAGGATGCAAAGTTCGTGTGTCCAATATCG
CCTCTTTGATAAATTAATCCTCCCCACATCCAAAGATGGATTACTCTCCAGAAGATTAAATACTCTGACGCCGAA
GGAAAAGAAGTACTGCCTGCAAGGGATATGCATCAGCAGAGTAATTTAATTTTTATTTACAGAGATTGTGGGAGT
GTGCTGAGCGCAAGACACGCAAATCTTCCGGCGTCGATGGTACGCGCAACCCTTGCTAAAGCATTGGTGATATAA
TTCTCGTTCCAGCTGTATCTGTACTGGCTCTCATCGATTCGAAAACGAACGCATTCCCCTTGTCCACCGTAATCA
TTGAGCAATTCAGGCCTCCCGTTGGAAAATTTGTCGTCGGTAGATCGCTATACTGCACCTTCAAAAATCCAATCT
AACGAGAACCCAAAGAACTTCCCGCAGGTGAATACGTTTCAATACCGGCCCTCTGTCCTTGTCTCTTGAATATCC
TACGAAGGACTGATTGACGAAGGAGAATCTCCCGAGACTGCAGCAGTGAGGGAGTTGGAAGAAGAAACTGGTTTC
AAAGCGTACAGTATCTTCGAAAGTTCGGATATTGTCGTCAGCGATCCTGGTGCGGCGCTTCGGAGTTCAACATTC
ATGGTCTATTCAGAAGCCTGATCACATCCATAAGGGATGACGAGTGCCAATATGAAACTCGTAATTGCCAATGTA
TTGCTCGATGACAAGCTAGAGTTGCCTGAACAAAAGCTGGAAGCTGGAGCTGGAGAATTTATAAAATGTCGTGTT
GTTGATTTAGACAAATTGCACGATGAACTTAAAGGTGAATACGTATAGTCAATTCCATCTTCTCGAAGTCTCACA
GACAAAATATTCAGAATATGCTAGAAAGGTTCAAAGCCATTAGACTTAATTTCACACGTTCCACTTACTGCATTT
ACTCAACAGGGCTTTATTGTTGACGCCAGGCTATCTCATCTTGCCACTGGCTTCACATTAGCACAGCAGTTCCGG
ATTGGATTGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail