Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059660
Gene name
Locationscaffold_3:1682816..1685432
Strand+
Gene length (bp)2616
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05285 SDA1 SDA1 7.5E-46 436 587
PF05285 SDA1 SDA1 8.5E-33 585 716
PF08158 NUC130_3NT NUC130/3NT domain 5.7E-23 60 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10342|SDA1_SCHPO Protein sda1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sda1 PE=3 SV=2 6 713 1.0E-152
sp|P53313|SDA1_YEAST Protein SDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDA1 PE=1 SV=1 3 724 1.0E-132
sp|Q9NVU7|SDA1_HUMAN Protein SDA1 homolog OS=Homo sapiens GN=SDAD1 PE=1 SV=3 7 724 6.0E-116
sp|Q6NV26|SDA1_DANRE Protein SDA1 homolog OS=Danio rerio GN=sdad1 PE=2 SV=1 7 726 2.0E-115
sp|Q80UZ2|SDA1_MOUSE Protein SDA1 homolog OS=Mus musculus GN=Sdad1 PE=1 SV=1 7 716 4.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10342|SDA1_SCHPO Protein sda1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sda1 PE=3 SV=2 6 713 1.0E-152
sp|P53313|SDA1_YEAST Protein SDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDA1 PE=1 SV=1 3 724 1.0E-132
sp|Q9NVU7|SDA1_HUMAN Protein SDA1 homolog OS=Homo sapiens GN=SDAD1 PE=1 SV=3 7 724 6.0E-116
sp|Q6NV26|SDA1_DANRE Protein SDA1 homolog OS=Danio rerio GN=sdad1 PE=2 SV=1 7 726 2.0E-115
sp|Q80UZ2|SDA1_MOUSE Protein SDA1 homolog OS=Mus musculus GN=Sdad1 PE=1 SV=1 7 716 4.0E-110
sp|Q5XIQ5|SDA1_RAT Protein SDA1 homolog OS=Rattus norvegicus GN=Sdad1 PE=1 SV=1 7 716 2.0E-109
sp|Q2VPG3|SDA1_XENLA Protein SDA1 homolog OS=Xenopus laevis GN=sdad1 PE=2 SV=1 7 724 5.0E-108
sp|A5D7C2|SDA1_BOVIN Protein SDA1 homolog OS=Bos taurus GN=SDAD1 PE=2 SV=1 7 724 4.0E-107
sp|A4IIB1|SDA1_XENTR Protein SDA1 homolog OS=Xenopus tropicalis GN=sdad1 PE=2 SV=1 7 724 2.0E-106
sp|A7S6A5|SDA1_NEMVE Protein SDA1 homolog OS=Nematostella vectensis GN=sdad1 PE=3 SV=1 7 713 4.0E-104
sp|Q55DE2|SDA1_DICDI Protein SDA1 homolog OS=Dictyostelium discoideum GN=sdad1 PE=3 SV=1 1 539 3.0E-102
sp|Q7KKH3|SDA1_DROME Protein SDA1 homolog OS=Drosophila melanogaster GN=Mys45A PE=1 SV=1 7 481 2.0E-92
sp|Q9NEU2|SDA1_CAEEL Protein SDA1 homolog OS=Caenorhabditis elegans GN=pro-3 PE=1 SV=4 10 481 4.0E-71
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059660
MGRGLLLTTNLPQLQNLIKRDPLAYKEEFLQQWTHYNSVREIFKISPDEQAQNFRELVSFISQVATCYPKETKDF
PSHISSLLLDNYGSLSAEMRKVLVQNLVMLRNKDVISSIQLLQTLFPLLPRTTSSTLRSSIRKTILTDIRTANLR
ARNHKLNKAVQSMLFSMVERGANGEVIGDKGKFKATNATHDAKPFDGEEALWAIILTKELWKKSIWNDAKTVSIM
ALGCLHPVTKVQSGSLHFFLSSEEDEEDGSDEEEEIDVRALHHRREINKKTKSADKKLRQKLKTAKKQKHAHDKK
RLTGDAPNFPALNLLYDPQTFAEKLYDVLNNHDKRFSLDHKILIMHLLARVMGVHKLCVLGFYTYIVKYLTYKQL
RVPAILVALAQSVHELTPPDVLIPVIRKIAQEFIHPGVAGEVISAGLNSVREVCRRQPWAMEEDLLGDLVEYRKS
RDKAVTAAARGLLRLYREVNPTMLKRRERGKDASMGLASGVQPLPFGHSAEAVASIEGLDLLEEHLAKLRKEGAS
SQGDNDDDDDDAAWEGWDEDSSDSSSESEGWIDVEDDNDELVISDSEDEDNNGNKEVAPKLDTTETKFSQLATTK
ILTPADFSILNDLKLQVASKAAESGGSRAKRKLAELESSKHLNSGQNEAFISENDIMGPRKKAKADYAERMASIQ
KGRDGREKFGSNKGKQNKGTPSSSTNREKARNKPIMMILSSGGGAGQEKGIPA*
Coding >AgabiH97|059660
ATGGGTCGCGGTCTTCTCCTCACGACAAACCTCCCCCAGCTGCAAAACCTCATAAAAAGAGACCCTCTAGCGTAC
AAGGAGGAGTTTCTCCAGCAATGGACTCACTACAACAGCGTCCGTGAAATCTTCAAAATAAGTCCTGATGAACAG
GCCCAAAATTTTAGAGAGTTGGTTTCCTTTATATCCCAGGTGGCCACATGTTATCCCAAAGAAACCAAGGATTTC
CCCTCCCACATCTCCAGTCTTCTGCTCGATAACTATGGCAGTCTCTCTGCCGAGATGAGGAAAGTCCTTGTCCAG
AACCTCGTCATGTTGAGGAACAAAGATGTTATATCTTCAATCCAGTTACTCCAAACGCTCTTTCCCCTTCTTCCG
CGTACTACTTCCTCGACCCTACGTTCTTCTATCCGTAAAACTATCCTAACAGATATCCGGACTGCAAATCTTCGG
GCACGTAATCATAAACTTAACAAGGCTGTCCAGTCTATGCTTTTCAGTATGGTTGAGAGGGGGGCAAATGGCGAA
GTCATTGGTGATAAAGGGAAATTCAAAGCTACCAATGCCACTCATGATGCTAAGCCTTTTGATGGCGAAGAAGCT
CTTTGGGCGATCATTCTCACAAAAGAACTCTGGAAAAAATCCATTTGGAATGACGCAAAAACAGTGTCAATCATG
GCACTGGGTTGTCTTCACCCTGTTACCAAAGTCCAAAGTGGCTCGTTGCACTTTTTCTTAAGTAGTGAAGAAGAT
GAGGAAGATGGCAGTGACGAAGAAGAGGAGATCGACGTCAGGGCCTTGCATCATAGGAGAGAAATCAATAAAAAG
ACGAAAAGTGCCGACAAGAAGCTAAGGCAAAAGCTCAAGACTGCGAAAAAACAGAAACACGCTCATGATAAAAAA
CGGTTGACAGGAGATGCACCGAATTTCCCCGCTTTGAATCTCCTTTACGACCCTCAAACGTTTGCCGAAAAGCTC
TATGACGTTCTCAACAATCACGACAAACGCTTCTCTCTGGATCACAAAATTTTGATTATGCATTTACTCGCCCGC
GTCATGGGTGTTCACAAACTCTGTGTCCTTGGTTTCTATACTTACATCGTCAAATACCTGACATACAAGCAACTT
CGTGTGCCCGCCATCTTGGTCGCACTGGCACAATCTGTACACGAGCTGACTCCTCCAGACGTCCTCATTCCTGTC
ATCCGTAAAATTGCTCAAGAGTTCATCCACCCAGGTGTAGCAGGTGAAGTCATCTCTGCGGGGTTGAATTCTGTG
CGGGAGGTATGTAGAAGACAACCGTGGGCTATGGAGGAGGATCTGCTTGGTGATTTGGTCGAGTATAGGAAAAGT
CGGGATAAAGCTGTGACCGCTGCAGCTCGTGGTCTCCTGAGACTTTATAGAGAAGTTAACCCTACGATGCTTAAG
CGACGAGAACGGGGTAAAGACGCTTCAATGGGCTTGGCGAGTGGCGTTCAACCTTTGCCATTTGGCCATTCAGCC
GAAGCAGTGGCGAGTATTGAAGGACTTGATCTCCTGGAAGAACATTTAGCCAAGCTCCGGAAAGAAGGGGCATCA
TCTCAAGGCGATAATGATGATGACGATGATGACGCTGCTTGGGAAGGTTGGGATGAAGATTCGTCGGATTCTAGT
TCAGAGTCAGAAGGATGGATTGACGTAGAAGACGACAACGATGAATTAGTTATCAGCGACAGCGAAGACGAGGAC
AACAATGGGAACAAAGAGGTGGCCCCGAAGCTCGATACAACAGAGACCAAATTCTCGCAATTGGCAACTACAAAA
ATCCTGACGCCGGCCGATTTTTCCATTCTCAATGACCTAAAGCTGCAAGTAGCTTCGAAGGCCGCTGAATCAGGG
GGCTCCCGGGCTAAACGCAAGCTAGCCGAACTGGAATCCTCCAAACACCTCAATTCCGGACAAAATGAGGCTTTC
ATTTCGGAAAATGACATCATGGGGCCCAGAAAGAAAGCCAAGGCAGACTATGCTGAACGTATGGCATCTATCCAA
AAAGGCCGCGACGGCCGAGAGAAATTCGGATCGAATAAAGGCAAACAGAATAAAGGTACCCCTAGCAGCTCGACG
AACCGAGAAAAGGCAAGGAACAAACCTATCATGATGATACTTAGTAGTGGGGGCGGTGCGGGGCAAGAAAAAGGC
ATCCCTGCGTGA
Transcript >AgabiH97|059660
ATGGGTCGCGGTCTTCTCCTCACGACAAACCTCCCCCAGCTGCAAAACCTCATAAAAAGAGACCCTCTAGCGTAC
AAGGAGGAGTTTCTCCAGCAATGGACTCACTACAACAGCGTCCGTGAAATCTTCAAAATAAGTCCTGATGAACAG
GCCCAAAATTTTAGAGAGTTGGTTTCCTTTATATCCCAGGTGGCCACATGTTATCCCAAAGAAACCAAGGATTTC
CCCTCCCACATCTCCAGTCTTCTGCTCGATAACTATGGCAGTCTCTCTGCCGAGATGAGGAAAGTCCTTGTCCAG
AACCTCGTCATGTTGAGGAACAAAGATGTTATATCTTCAATCCAGTTACTCCAAACGCTCTTTCCCCTTCTTCCG
CGTACTACTTCCTCGACCCTACGTTCTTCTATCCGTAAAACTATCCTAACAGATATCCGGACTGCAAATCTTCGG
GCACGTAATCATAAACTTAACAAGGCTGTCCAGTCTATGCTTTTCAGTATGGTTGAGAGGGGGGCAAATGGCGAA
GTCATTGGTGATAAAGGGAAATTCAAAGCTACCAATGCCACTCATGATGCTAAGCCTTTTGATGGCGAAGAAGCT
CTTTGGGCGATCATTCTCACAAAAGAACTCTGGAAAAAATCCATTTGGAATGACGCAAAAACAGTGTCAATCATG
GCACTGGGTTGTCTTCACCCTGTTACCAAAGTCCAAAGTGGCTCGTTGCACTTTTTCTTAAGTAGTGAAGAAGAT
GAGGAAGATGGCAGTGACGAAGAAGAGGAGATCGACGTCAGGGCCTTGCATCATAGGAGAGAAATCAATAAAAAG
ACGAAAAGTGCCGACAAGAAGCTAAGGCAAAAGCTCAAGACTGCGAAAAAACAGAAACACGCTCATGATAAAAAA
CGGTTGACAGGAGATGCACCGAATTTCCCCGCTTTGAATCTCCTTTACGACCCTCAAACGTTTGCCGAAAAGCTC
TATGACGTTCTCAACAATCACGACAAACGCTTCTCTCTGGATCACAAAATTTTGATTATGCATTTACTCGCCCGC
GTCATGGGTGTTCACAAACTCTGTGTCCTTGGTTTCTATACTTACATCGTCAAATACCTGACATACAAGCAACTT
CGTGTGCCCGCCATCTTGGTCGCACTGGCACAATCTGTACACGAGCTGACTCCTCCAGACGTCCTCATTCCTGTC
ATCCGTAAAATTGCTCAAGAGTTCATCCACCCAGGTGTAGCAGGTGAAGTCATCTCTGCGGGGTTGAATTCTGTG
CGGGAGGTATGTAGAAGACAACCGTGGGCTATGGAGGAGGATCTGCTTGGTGATTTGGTCGAGTATAGGAAAAGT
CGGGATAAAGCTGTGACCGCTGCAGCTCGTGGTCTCCTGAGACTTTATAGAGAAGTTAACCCTACGATGCTTAAG
CGACGAGAACGGGGTAAAGACGCTTCAATGGGCTTGGCGAGTGGCGTTCAACCTTTGCCATTTGGCCATTCAGCC
GAAGCAGTGGCGAGTATTGAAGGACTTGATCTCCTGGAAGAACATTTAGCCAAGCTCCGGAAAGAAGGGGCATCA
TCTCAAGGCGATAATGATGATGACGATGATGACGCTGCTTGGGAAGGTTGGGATGAAGATTCGTCGGATTCTAGT
TCAGAGTCAGAAGGATGGATTGACGTAGAAGACGACAACGATGAATTAGTTATCAGCGACAGCGAAGACGAGGAC
AACAATGGGAACAAAGAGGTGGCCCCGAAGCTCGATACAACAGAGACCAAATTCTCGCAATTGGCAACTACAAAA
ATCCTGACGCCGGCCGATTTTTCCATTCTCAATGACCTAAAGCTGCAAGTAGCTTCGAAGGCCGCTGAATCAGGG
GGCTCCCGGGCTAAACGCAAGCTAGCCGAACTGGAATCCTCCAAACACCTCAATTCCGGACAAAATGAGGCTTTC
ATTTCGGAAAATGACATCATGGGGCCCAGAAAGAAAGCCAAGGCAGACTATGCTGAACGTATGGCATCTATCCAA
AAAGGCCGCGACGGCCGAGAGAAATTCGGATCGAATAAAGGCAAACAGAATAAAGGTACCCCTAGCAGCTCGACG
AACCGAGAAAAGGCAAGGAACAAACCTATCATGATGATACTTAGTAGTGGGGGCGGTGCGGGGCAAGAAAAAGGC
ATCCCTGCGTGA
Gene >AgabiH97|059660
ATGGGTCGCGGTCTTCTCCTCACGACAAACCTCCCCCAGCTGCAAAACCTCATAAAAAGAGACCCTCTAGCGTAC
AAGGAGGAGTTTCTCCAGCAATGGACTCACTACAACAGCGTCCGTGAAATCTTCAAAATAAGTCCTGATGAACAG
GCCCAAAATTTTAGAGAGTTGGTTTCCTTTATATCCCAGGTAACCACCATCGCAATCTCTCAGAACCATTCGTTT
CTGACCTAGGTCCCAGGTGGCCACATGTTATCCCAAAGAAACCAAGGATTTCCCCTCCCACATCTCCAGTCTTCT
GCTCGATAACTATGGCAGTCTCTCTGCCGAGATGAGGAAAGTCCTTGTCCAGAACCTCGTCATGTTGAGGAACAA
AGATGTTATATCTTCAATCCAGTCTGTCAATCTCTTTTTCTAACGCTCACGTCTCGGCTTGAACTCGATTTTTAG
GTTACTCCAAACGCTCTTTCCCCTTCTTCCGCGTACTACTTCCTCGACCCTACGTTCTTCTATCCGTAAAACTAT
CCTAACAGATATCCGGACTGCAAATCTTCGGGCACGTAATCATAAACTTAACAAGGCTGTCCAGTCTATGCTTTT
CAGTATGGTTGAGAGGGGGGCAAATGGCGAAGTCATTGGTGATAAAGGGAAATTCAAAGCTACCAATGCCACTCA
TGATGCTAAGCCTTTTGATGGCGAAGAAGCTCTTTGGGCGATCATTCTCACAAAAGAACTCTGGAAAAAATCCAT
TTGGTTCGTCGCCTTTTTTTAATAATCGCGTGTATGTTACTGATTGAAATGCAGGAATGACGCAAAAACAGTGTC
AATCATGGCACTGGGTTGTCTTCACCCTGTTACCAAAGTCCAAAGTGGCTCGTTGCACTTTTTCTTAAGTAGTGA
AGAAGATGAGGAAGATGGCAGTGACGAAGAAGAGGTATGTGTTTGACTCAAGATCATCACCATTTGACCTGACCG
AAAGTCAAGGAGATCGACGTCAGGGCCTTGCATCATAGGAGAGAAATCAATAAAAAGACGAAAAGTGCCGACAAG
AAGCTAAGGCAAAAGCTCAAGACTGCGAAAAAAGTATGGATATTGAATTGATTCAGTGTTTTTTTGTGTGGCTAA
ATCTGACTCATAAACAGCAGAAACACGCTCATGATAAAAAACGGTTGACAGGAGATGCACCGAATTTCCCCGCTT
TGAATCTCCTTTACGACCCTCAAACGTTTGCCGAAAAGCTCTATGACGTTCTCAACAATCACGACAAACGCTTCT
CTCTGGATCACAAAATTTTGATTATGCATTTACTCGCCCGCGTCATGGGTGTTCACAAACTCTGTGTCCTTGGTT
TCTATACTTACATCGTCAAATACCTGACATACAAGCAACTTCGTGTGCCCGCCATCTTGGTCGCACTGGCACAAT
CTGTACACGAGCTGACTCCTCCAGACGTCCTCATTCCTGTCATCCGTAAAATTGCTCAAGAGTTCATCCACCCAG
GTGTAGCAGGTGAAGTCATCTCTGCGGGGTTGAATTCTGTGCGGGAGGTATGTAGAAGACAACCGTGGGCTATGG
AGGAGGATCTGCTTGGTGATTTGGTCGAGTATAGGAAAAGTCGGGATAAAGCTGTGACCGCTGCAGCTCGTGGTC
TCCTGAGACTTTATAGAGAAGTTAACCCTACGATGCTTAAGCGACGAGAACGGGTCAGCGTTCAATCTCTCTCTC
AACTACCATCTTGCTTATCTTCGGTTGTACTACAGGGTAAAGACGCTTCAATGGGCTTGGCGAGTGGCGTTCAAC
CTTTGCCATTTGGCCATTCAGCCGAAGCAGTGGCGAGTATTGAAGGACTTGATGTATGTTTTTTGGTTGCTGCTC
CCGAATCAGCTTGTAATGTGATTTTTGTACAGCTCCTGGAAGAACATTTAGCCAAGCTCCGGAAAGAAGGGGCAT
CATCTCAAGGCGATAATGATGATGACGATGATGACGCTGCTTGGGAAGGTTGGGATGAAGATTCGTCGGATTCTA
GTTCAGAGTCAGAAGGATGGATTGACGTAGAAGACGACAACGATGAATTAGTTATCAGCGACAGCGAAGACGAGG
ACAACAATGGGAACAAAGAGGTGGCCCCGAAGCTCGATACAACAGAGACCAAATTCTCGCAATTGGCAACTACAA
AAGTGAATGCGTCTGATTCGGCCCAATTCTTTCAGAAGCTAATGGGAACTTTAGATCCTGACGCCGGCCGATTTT
TCCATTCTCAATGACCTAAAGCTGCAAGTAGCTTCGAAGGCCGCTGAATCAGGGGGCTCCCGGGCTAAACGCAAG
CTAGCCGAACTGGAATCCTCCAAACACCTCAATTCCGGACAAAATGAGGCTTTCATTTCGGAAAATGACATCATG
GGGCCCAGAAAGAAAGCCAAGGCAGACTATGCTGAACGTATGGCATCTATCCAAAAAGGCCGCGACGGCCGAGAG
AAATTCGGATCGAATAAAGGCAAACAGAATAAAGGTACCCCTAGCAGCTCGACGAACCGAGAAAAGGCAAGGAAC
AAACCTATCATGATGATACTTAGTAGTGGGGGCGGTGCGGGGCAAGAAAAAGGCATCCCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail