Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059630
Gene name
Locationscaffold_3:1675289..1679757
Strand-
Gene length (bp)4468
Transcript length (bp)3750
Coding sequence length (bp)3750
Protein length (aa) 1250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 2.9E-05 798 833
PF08238 Sel1 Sel1 repeat 5.4E-03 835 869
PF08238 Sel1 Sel1 repeat 8.6E-08 872 906
PF08238 Sel1 Sel1 repeat 4.0E+00 910 947
PF08238 Sel1 Sel1 repeat 5.9E-10 949 984
PF08238 Sel1 Sel1 repeat 9.0E-03 985 1021
PF08238 Sel1 Sel1 repeat 2.3E-04 1023 1058
PF06201 PITH PITH domain 7.4E-35 1093 1232
PF17811 JHD Jumonji helical domain 4.9E-08 371 420
PF02373 JmjC JmjC domain, hydroxylase 7.5E-06 266 366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO41|JHD1_CRYNB JmjC domain-containing histone demethylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=JHD1 PE=3 SV=1 85 570 3.0E-103
sp|P0CO40|JHD1_CRYNJ JmjC domain-containing histone demethylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=JHD1 PE=3 SV=1 85 570 4.0E-103
sp|Q4P5U1|JHD1_USTMA JmjC domain-containing histone demethylation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=JHD1 PE=3 SV=1 7 407 2.0E-100
sp|Q6C423|JHD1_YARLI JmjC domain-containing histone demethylation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=JHD1 PE=3 SV=1 21 434 3.0E-86
sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 41 472 1.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO41|JHD1_CRYNB JmjC domain-containing histone demethylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=JHD1 PE=3 SV=1 85 570 3.0E-103
sp|P0CO40|JHD1_CRYNJ JmjC domain-containing histone demethylation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=JHD1 PE=3 SV=1 85 570 4.0E-103
sp|Q4P5U1|JHD1_USTMA JmjC domain-containing histone demethylation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=JHD1 PE=3 SV=1 7 407 2.0E-100
sp|Q6C423|JHD1_YARLI JmjC domain-containing histone demethylation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=JHD1 PE=3 SV=1 21 434 3.0E-86
sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 41 472 1.0E-81
sp|Q80TJ7|PHF8_MOUSE Histone lysine demethylase PHF8 OS=Mus musculus GN=Phf8 PE=1 SV=2 41 417 2.0E-79
sp|Q5U263|KDM2A_XENTR Lysine-specific demethylase 2A OS=Xenopus tropicalis GN=kdm2a PE=2 SV=1 103 419 1.0E-78
sp|Q5AW75|JHD1_EMENI JmjC domain-containing histone demethylation protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=jhd1 PE=3 SV=1 10 410 1.0E-78
sp|P0CF52|KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio GN=jhdm1db PE=2 SV=1 41 438 2.0E-78
sp|Q9UPP1|PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens GN=PHF8 PE=1 SV=3 41 417 3.0E-78
sp|Q4WHB7|JHD1_ASPFU JmjC domain-containing histone demethylation protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=jhd1 PE=3 SV=1 40 410 5.0E-78
sp|Q3UWM4|KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus GN=Kdm7a PE=2 SV=2 24 446 2.0E-77
sp|Q6ZMT4|KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens GN=KDM7A PE=1 SV=2 24 446 6.0E-77
sp|Q9Y2K7|KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens GN=KDM2A PE=1 SV=3 88 419 3.0E-75
sp|P59997|KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus GN=Kdm2a PE=1 SV=2 88 495 4.0E-74
sp|Q5RHD1|KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio GN=kdm7a PE=2 SV=2 24 412 3.0E-73
sp|Q08D35|KDM7A_XENTR Lysine-specific demethylase 7A OS=Xenopus tropicalis GN=kdm7a PE=2 SV=1 41 446 1.0E-72
sp|Q8NHM5|KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens GN=KDM2B PE=1 SV=1 117 419 1.0E-71
sp|Q6P1G2|KDM2B_MOUSE Lysine-specific demethylase 2B OS=Mus musculus GN=Kdm2b PE=1 SV=1 117 424 2.0E-71
sp|Q640I9|KDM2B_XENLA Lysine-specific demethylase 2B OS=Xenopus laevis GN=kdm2b PE=2 SV=1 124 408 8.0E-70
sp|Q9VHH9|JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster GN=Kdm2 PE=1 SV=2 128 408 9.0E-70
sp|Q6P949|PHF2_DANRE Lysine-specific demethylase phf2 OS=Danio rerio GN=phf2 PE=2 SV=3 41 412 4.0E-69
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 735 1061 2.0E-68
sp|Q5A847|JHD1_CANAL JmjC domain-containing histone demethylation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=JHD1 PE=3 SV=1 16 419 1.0E-67
sp|Q6BXJ4|JHD1_DEBHA JmjC domain-containing histone demethylation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=JHD1 PE=3 SV=2 19 407 2.0E-67
sp|Q9WTU0|PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus GN=Phf2 PE=1 SV=2 41 434 4.0E-67
sp|E6ZGB4|PHF2_DICLA Lysine-specific demethylase phf2 OS=Dicentrarchus labrax GN=phf2 PE=3 SV=1 41 418 3.0E-66
sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens GN=PHF2 PE=1 SV=4 41 434 3.0E-66
sp|Q75AL5|JHD1_ASHGO JmjC domain-containing histone demethylation protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=JHD1 PE=3 SV=2 16 408 1.0E-60
sp|Q95Q98|JHD1_CAEEL JmjC domain-containing histone demethylation protein 1 OS=Caenorhabditis elegans GN=jhdm-1 PE=3 SV=2 135 409 1.0E-59
sp|Q60V67|JHD1_CAEBR JmjC domain-containing histone demethylation protein 1 OS=Caenorhabditis briggsae GN=jhdm-1 PE=3 SV=2 130 409 2.0E-59
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 731 1078 5.0E-58
sp|O94603|JHD1_SCHPO Putative JmjC domain-containing histone demethylation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jhd1 PE=1 SV=1 125 404 9.0E-55
sp|Q9GYI0|KDM7_CAEEL Lysine-specific demethylase 7 homolog OS=Caenorhabditis elegans GN=jmjd-1.2 PE=1 SV=1 39 411 2.0E-54
sp|P40034|JHD1_YEAST JmjC domain-containing histone demethylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JHD1 PE=1 SV=1 40 404 5.0E-54
sp|Q6CIC9|JHD1_KLULA JmjC domain-containing histone demethylation protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=JHD1 PE=3 SV=1 168 413 1.0E-51
sp|Q6FPL6|JHD1_CANGA JmjC domain-containing histone demethylation protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=JHD1 PE=3 SV=1 150 396 8.0E-48
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 751 1063 2.0E-40
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 668 1021 5.0E-39
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 773 1062 3.0E-36
sp|Q9SQZ9|PITH1_ARATH PITH domain-containing protein At3g04780 OS=Arabidopsis thaliana GN=At3g04780 PE=1 SV=2 1085 1248 2.0E-24
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 1095 1238 1.0E-23
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 1095 1238 4.0E-23
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 1095 1238 6.0E-23
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 731 950 2.0E-21
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 1065 1235 2.0E-21
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 731 950 5.0E-21
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 817 1054 2.0E-16
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 783 1083 1.0E-12
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 854 1083 2.0E-12
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 811 1050 2.0E-12
sp|Q94C27|FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana GN=At1g70590 PE=2 SV=1 807 1068 3.0E-12
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 890 1043 1.0E-11
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 813 1057 2.0E-11
sp|Q5UP92|YL018_MIMIV Putative sel1-like repeat-containing protein L18 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L18 PE=4 SV=1 862 1042 2.0E-11
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 799 998 5.0E-11
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 817 988 5.0E-11
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 817 987 5.0E-10
sp|Q29L80|PITH1_DROPS PITH domain-containing protein GA19395 OS=Drosophila pseudoobscura pseudoobscura GN=GA19395 PE=3 SV=1 1093 1232 6.0E-10
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 938 1061 1.0E-09
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 938 1061 1.0E-09
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 946 1070 2.0E-09
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 817 999 3.0E-09
sp|Q9VK68|PITH1_DROME PITH domain-containing protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1 1091 1249 9.0E-09
sp|Q6DJI5|PITH1_XENLA PITH domain-containing protein 1 OS=Xenopus laevis GN=pithd1 PE=2 SV=1 1091 1249 2.0E-08
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 849 1004 3.0E-08
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 849 1013 5.0E-08
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 903 1083 8.0E-08
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 775 1062 1.0E-07
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 803 1057 1.0E-07
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 926 1061 3.0E-07
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 813 983 4.0E-07
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 761 1061 4.0E-07
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 775 1054 5.0E-07
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 926 1061 6.0E-07
sp|Q95ZI6|PITH1_CAEEL PITH domain-containing protein ZK353.9 OS=Caenorhabditis elegans GN=ZK353.9 PE=3 SV=1 1093 1232 6.0E-07
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 847 1013 7.0E-07
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 847 1013 8.0E-07
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 847 1013 8.0E-07
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 847 1013 9.0E-07
sp|O25021|HCPE_HELPY Putative beta-lactamase HcpE OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hcpE PE=3 SV=1 817 1058 1.0E-06
sp|Q9ZMJ9|HCPE_HELPJ Putative beta-lactamase HcpE OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hcpE PE=3 SV=1 817 1058 2.0E-06
sp|Q5UQH0|YR815_MIMIV Putative sel1-like repeat-containing protein R815 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R815 PE=4 SV=1 813 979 2.0E-06
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 803 1057 3.0E-06
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 782 1054 3.0E-06
sp|Q9C6B6|HRD3B_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3B OS=Arabidopsis thaliana GN=HRD3B PE=3 SV=1 825 1053 4.0E-06
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 926 1061 4.0E-06
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 943 1054 5.0E-06
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 780 1054 6.0E-06
sp|Q9JZ25|Y1327_NEIMB Uncharacterized protein NMB1327 OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB1327 PE=1 SV=1 774 1057 7.0E-06
sp|Q9JZ25|Y1327_NEIMB Uncharacterized protein NMB1327 OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB1327 PE=1 SV=1 786 1061 7.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 781 1057 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059630
MSRSNTPERSNSTSQLRDESCPACVEGQTHVLNALEKERWIRCDACKTWYHWRCVGQGEDIDSIDKWFCQKCIEE
KPSRTITRKAPARKSSRIKTQRDYASLDSGISFDPARWLRILQEKRTDGDPFRRMYGGDLRLSWLDEDEMAMREP
IVIEKPEGLEIKMPSSDLTVNEIAELVGKDVAVEVIDVATQSTSPGWTLEKWAEYVGLEPEKRDKILNVISLEIS
STKLADMIVPPRIVRELDWVENFWPSSRKGKGNVYPKVQLYCLMGVANAWTDWHVDFAGSSVYYHILHGSKVFYF
IRPTPANLAAYERWSGTELQYQSWLGDMVDEVFKVELVEGNTMIIPSGWIHAVYTPVDTIVFGGNFLHSYSVPTQ
VRVRNIEIATSVPKKFRFPHFAKLCWYVGEKYLRDVRSNGEHEFSPRLLGSLTALADFLVSEARVLEHGGETAKK
EAREQIPTDRVKDGPAVARELRWRLRLASGSASDDDSTRRANGHVNGVKRRRVEEEGSEEGLMRFRNFKPRVWDR
IEERVEEAVSECRVGVRPGGEEGWSDVWVGTEGTTAEGEEAQVSTQKTVVVKIHTRLTMNVHHANHSVPTLDSLS
LHEPPSRAASSLAHHPPPRHAATLPEFHGYNPLYAAASDVLGMAPPPPPPGPPPPPLAYSPHPPMGHSFSPSPSS
YAGSYDSFPPPSLYPPSEIESRPSLERSTTFKSVALSSTKSRAIDLTTPPYTKDYIDQYRQRIKGDPDPEAHFAY
AKYLIDAAKHIRAAAQDQRAARKYSEILIQEALKVVKRLATQGEAYHEAQFFLANCHGTGALGLQVDHERAYHLY
LQAAKQNHAPASYRVAVCNEIGAGTRKEPARAAAFYRKAASLGDTPAMFKLGMILLQGSLEQPRNPREAITWLKR
AAEQADEDNPHALHELGVLHEQPNSNIVPYDPGYAKALFTQAAQLGYTQSQYKLGQCYEYGNLGCPVDPRRSIAW
YTKAAEKGDSEAELALSGWYLTGSEGVLKQSDSEAYLWARRAANKGLSKAEYAVGYYAEVGIGIKQDMEFAKKWY
MRAAAQGNKKAMNPADGVEADGEQASAGTTNAAGGQGRVYDYLNCLNEAENHSLKSILQQKSKNSSENYLFSDAD
AQLLLNIHFNQAVRIRSLAITCSDLSQAPKSIKLVVNKPSLGFEDVENAQDSQVAQVIELKEDQVRHGQPIALRY
VRFQSVNSLHIFVESNHGGGDETRIDAIDISGFPIEATKDLSGLKNTES*
Coding >AgabiH97|059630
ATGAGTCGGTCGAATACTCCAGAACGCAGCAACTCGACCTCGCAGCTGAGAGACGAGTCTTGTCCTGCCTGTGTG
GAGGGTCAAACCCACGTTCTCAATGCGCTGGAAAAGGAGCGTTGGATCAGATGCGACGCCTGTAAAACATGGTAT
CATTGGCGCTGTGTTGGTCAAGGCGAGGACATTGATAGCATAGACAAATGGTTCTGTCAGAAATGCATCGAAGAA
AAGCCTTCAAGGACTATCACCCGTAAAGCTCCAGCCCGTAAATCCTCTCGTATCAAGACACAACGCGATTATGCG
AGTTTGGATTCTGGTATCAGTTTCGATCCTGCGCGGTGGTTGAGGATTCTGCAAGAGAAACGAACGGATGGAGAT
CCTTTTAGGCGAATGTATGGAGGTGACCTTCGGTTGTCGTGGTTGGATGAAGATGAGATGGCTATGCGTGAACCT
ATCGTCATTGAAAAACCAGAGGGGTTGGAGATAAAGATGCCGTCGAGTGATCTCACCGTGAATGAAATTGCCGAA
CTCGTTGGTAAGGATGTAGCTGTAGAAGTCATTGATGTTGCTACTCAATCCACGTCACCGGGATGGACACTGGAA
AAATGGGCAGAATATGTAGGATTGGAACCGGAGAAACGGGACAAGATCCTCAACGTCATATCATTGGAAATATCG
TCTACTAAATTAGCCGACATGATTGTGCCTCCTCGAATTGTGCGGGAACTGGACTGGGTTGAAAACTTTTGGCCG
AGTTCTCGTAAAGGCAAGGGGAATGTTTATCCCAAGGTTCAATTGTACTGTCTTATGGGGGTTGCCAATGCGTGG
ACGGACTGGCACGTTGACTTTGCTGGTTCTTCGGTTTATTACCACATCTTGCACGGTTCCAAGGTTTTCTACTTT
ATCCGACCGACGCCTGCCAACCTAGCTGCTTATGAGCGGTGGTCGGGCACTGAATTGCAATATCAATCGTGGCTC
GGAGACATGGTAGATGAGGTATTTAAAGTAGAACTTGTGGAAGGAAACACTATGATAATTCCTTCTGGCTGGATA
CACGCCGTCTACACTCCGGTTGACACGATCGTGTTTGGAGGGAATTTTCTGCATTCTTATAGTGTTCCAACGCAG
GTCCGGGTGCGTAATATTGAAATAGCGACGTCTGTACCCAAGAAATTCCGATTTCCGCATTTTGCCAAGTTGTGT
TGGTATGTGGGAGAAAAGTACCTTCGGGACGTGCGGTCCAATGGAGAGCACGAGTTTTCACCACGACTGCTTGGG
TCGCTAACGGCGCTTGCGGATTTTCTTGTGTCCGAAGCTCGGGTATTGGAGCATGGTGGGGAAACGGCGAAAAAG
GAGGCTAGAGAGCAGATACCTACTGACCGAGTGAAAGATGGGCCTGCGGTGGCGAGAGAGCTTCGGTGGCGGCTA
CGACTGGCGAGTGGGTCTGCCAGTGACGATGATAGCACACGGAGAGCGAATGGGCATGTGAATGGGGTGAAGAGA
CGGCGGGTGGAAGAGGAGGGGTCGGAGGAAGGGTTGATGAGGTTTAGGAATTTTAAACCGCGTGTATGGGACCGG
ATTGAAGAGAGAGTGGAAGAGGCGGTGAGTGAGTGTCGGGTGGGAGTGCGCCCTGGGGGTGAGGAGGGCTGGAGT
GATGTGTGGGTGGGAACAGAGGGGACGACGGCGGAGGGCGAAGAGGCACAGGTGAGCACACAGAAGACGGTGGTG
GTAAAGATTCACACACGCTTGACAATGAACGTCCACCACGCCAACCACTCTGTGCCTACGCTCGACTCTCTTTCC
TTGCACGAGCCTCCGTCCAGAGCTGCCTCTTCCCTCGCTCACCACCCTCCTCCACGCCATGCTGCCACTCTTCCC
GAGTTTCACGGCTACAACCCCCTCTATGCTGCTGCCTCTGATGTCCTCGGCATGGCCCCTCCTCCTCCTCCACCT
GGTCCTCCCCCTCCTCCCCTAGCGTACTCTCCCCACCCTCCCATGGGCCACTCCTTCAGCCCCTCTCCCTCCTCT
TACGCCGGTTCTTATGACTCCTTCCCTCCTCCCTCCCTCTACCCACCTTCCGAAATCGAATCACGGCCTTCTCTG
GAACGTTCAACGACCTTTAAATCCGTCGCCCTCTCCTCCACCAAGAGCCGAGCAATCGATCTCACAACTCCCCCG
TACACAAAAGACTACATTGACCAGTACAGGCAACGGATAAAGGGGGACCCCGATCCAGAGGCACATTTCGCGTAT
GCCAAGTATCTCATAGATGCAGCAAAGCATATCCGTGCCGCCGCTCAGGACCAGAGGGCCGCGAGAAAGTACAGT
GAGATTCTCATCCAAGAGGCTCTCAAGGTTGTCAAACGGCTGGCTACTCAGGGTGAGGCATATCACGAAGCCCAG
TTCTTTCTGGCAAATTGCCATGGAACGGGCGCGTTGGGTCTTCAGGTCGACCATGAACGGGCATACCACCTCTAT
CTCCAGGCCGCCAAACAGAACCACGCGCCCGCTTCGTATCGCGTGGCCGTGTGCAATGAAATCGGAGCTGGGACG
AGAAAGGAGCCTGCCAGGGCTGCAGCATTTTATCGCAAGGCGGCTTCGCTAGGTGACACTCCAGCCATGTTCAAG
CTGGGCATGATTCTTCTTCAAGGATCTCTCGAACAGCCAAGAAATCCGCGCGAGGCTATTACATGGCTCAAACGC
GCCGCTGAACAGGCCGATGAAGACAACCCTCACGCACTGCATGAGCTGGGTGTTCTGCACGAACAGCCTAATTCA
AATATTGTGCCCTATGATCCTGGTTATGCTAAAGCCCTCTTTACGCAGGCAGCGCAACTGGGATACACTCAATCA
CAATACAAGCTCGGACAGTGCTACGAGTATGGTAATCTGGGCTGTCCAGTGGATCCTCGGCGGTCCATAGCTTGG
TACACCAAGGCGGCTGAAAAGGGCGATTCAGAAGCCGAGCTGGCACTGAGCGGCTGGTATCTTACGGGGAGCGAG
GGAGTGCTGAAGCAGAGTGATTCAGAGGCATACCTGTGGGCACGGCGCGCGGCTAACAAGGGGTTAAGTAAAGCC
GAGTACGCGGTGGGGTACTATGCCGAGGTGGGGATCGGGATCAAGCAGGACATGGAGTTTGCGAAAAAGTGGTAT
ATGCGAGCAGCAGCACAAGGGAACAAAAAGGCGATGAACCCGGCTGACGGAGTTGAAGCGGATGGGGAACAAGCG
AGCGCTGGGACGACCAACGCGGCAGGAGGCCAAGGACGAGTGTACGATTATCTCAACTGTCTCAACGAGGCAGAG
AACCACTCCCTCAAGAGCATCCTCCAACAAAAGTCAAAAAACTCGTCTGAAAATTACCTTTTCAGCGATGCAGAT
GCACAGCTCCTGCTCAACATTCATTTCAATCAAGCCGTGCGCATCCGCTCTCTCGCCATCACCTGCTCCGATCTC
TCTCAGGCACCCAAATCCATCAAGCTCGTCGTCAACAAACCTTCTTTAGGCTTTGAGGATGTGGAAAATGCCCAA
GACTCGCAGGTCGCGCAGGTTATTGAGCTGAAGGAGGATCAAGTCCGACATGGACAGCCGATTGCACTTCGATAT
GTGAGATTTCAAAGCGTCAACAGTCTGCATATCTTTGTCGAGTCTAATCATGGAGGAGGGGATGAAACCCGAATC
GATGCCATCGATATCTCTGGTTTTCCGATCGAAGCCACAAAGGACCTCAGCGGGTTGAAGAACACCGAATCTTAG
Transcript >AgabiH97|059630
ATGAGTCGGTCGAATACTCCAGAACGCAGCAACTCGACCTCGCAGCTGAGAGACGAGTCTTGTCCTGCCTGTGTG
GAGGGTCAAACCCACGTTCTCAATGCGCTGGAAAAGGAGCGTTGGATCAGATGCGACGCCTGTAAAACATGGTAT
CATTGGCGCTGTGTTGGTCAAGGCGAGGACATTGATAGCATAGACAAATGGTTCTGTCAGAAATGCATCGAAGAA
AAGCCTTCAAGGACTATCACCCGTAAAGCTCCAGCCCGTAAATCCTCTCGTATCAAGACACAACGCGATTATGCG
AGTTTGGATTCTGGTATCAGTTTCGATCCTGCGCGGTGGTTGAGGATTCTGCAAGAGAAACGAACGGATGGAGAT
CCTTTTAGGCGAATGTATGGAGGTGACCTTCGGTTGTCGTGGTTGGATGAAGATGAGATGGCTATGCGTGAACCT
ATCGTCATTGAAAAACCAGAGGGGTTGGAGATAAAGATGCCGTCGAGTGATCTCACCGTGAATGAAATTGCCGAA
CTCGTTGGTAAGGATGTAGCTGTAGAAGTCATTGATGTTGCTACTCAATCCACGTCACCGGGATGGACACTGGAA
AAATGGGCAGAATATGTAGGATTGGAACCGGAGAAACGGGACAAGATCCTCAACGTCATATCATTGGAAATATCG
TCTACTAAATTAGCCGACATGATTGTGCCTCCTCGAATTGTGCGGGAACTGGACTGGGTTGAAAACTTTTGGCCG
AGTTCTCGTAAAGGCAAGGGGAATGTTTATCCCAAGGTTCAATTGTACTGTCTTATGGGGGTTGCCAATGCGTGG
ACGGACTGGCACGTTGACTTTGCTGGTTCTTCGGTTTATTACCACATCTTGCACGGTTCCAAGGTTTTCTACTTT
ATCCGACCGACGCCTGCCAACCTAGCTGCTTATGAGCGGTGGTCGGGCACTGAATTGCAATATCAATCGTGGCTC
GGAGACATGGTAGATGAGGTATTTAAAGTAGAACTTGTGGAAGGAAACACTATGATAATTCCTTCTGGCTGGATA
CACGCCGTCTACACTCCGGTTGACACGATCGTGTTTGGAGGGAATTTTCTGCATTCTTATAGTGTTCCAACGCAG
GTCCGGGTGCGTAATATTGAAATAGCGACGTCTGTACCCAAGAAATTCCGATTTCCGCATTTTGCCAAGTTGTGT
TGGTATGTGGGAGAAAAGTACCTTCGGGACGTGCGGTCCAATGGAGAGCACGAGTTTTCACCACGACTGCTTGGG
TCGCTAACGGCGCTTGCGGATTTTCTTGTGTCCGAAGCTCGGGTATTGGAGCATGGTGGGGAAACGGCGAAAAAG
GAGGCTAGAGAGCAGATACCTACTGACCGAGTGAAAGATGGGCCTGCGGTGGCGAGAGAGCTTCGGTGGCGGCTA
CGACTGGCGAGTGGGTCTGCCAGTGACGATGATAGCACACGGAGAGCGAATGGGCATGTGAATGGGGTGAAGAGA
CGGCGGGTGGAAGAGGAGGGGTCGGAGGAAGGGTTGATGAGGTTTAGGAATTTTAAACCGCGTGTATGGGACCGG
ATTGAAGAGAGAGTGGAAGAGGCGGTGAGTGAGTGTCGGGTGGGAGTGCGCCCTGGGGGTGAGGAGGGCTGGAGT
GATGTGTGGGTGGGAACAGAGGGGACGACGGCGGAGGGCGAAGAGGCACAGGTGAGCACACAGAAGACGGTGGTG
GTAAAGATTCACACACGCTTGACAATGAACGTCCACCACGCCAACCACTCTGTGCCTACGCTCGACTCTCTTTCC
TTGCACGAGCCTCCGTCCAGAGCTGCCTCTTCCCTCGCTCACCACCCTCCTCCACGCCATGCTGCCACTCTTCCC
GAGTTTCACGGCTACAACCCCCTCTATGCTGCTGCCTCTGATGTCCTCGGCATGGCCCCTCCTCCTCCTCCACCT
GGTCCTCCCCCTCCTCCCCTAGCGTACTCTCCCCACCCTCCCATGGGCCACTCCTTCAGCCCCTCTCCCTCCTCT
TACGCCGGTTCTTATGACTCCTTCCCTCCTCCCTCCCTCTACCCACCTTCCGAAATCGAATCACGGCCTTCTCTG
GAACGTTCAACGACCTTTAAATCCGTCGCCCTCTCCTCCACCAAGAGCCGAGCAATCGATCTCACAACTCCCCCG
TACACAAAAGACTACATTGACCAGTACAGGCAACGGATAAAGGGGGACCCCGATCCAGAGGCACATTTCGCGTAT
GCCAAGTATCTCATAGATGCAGCAAAGCATATCCGTGCCGCCGCTCAGGACCAGAGGGCCGCGAGAAAGTACAGT
GAGATTCTCATCCAAGAGGCTCTCAAGGTTGTCAAACGGCTGGCTACTCAGGGTGAGGCATATCACGAAGCCCAG
TTCTTTCTGGCAAATTGCCATGGAACGGGCGCGTTGGGTCTTCAGGTCGACCATGAACGGGCATACCACCTCTAT
CTCCAGGCCGCCAAACAGAACCACGCGCCCGCTTCGTATCGCGTGGCCGTGTGCAATGAAATCGGAGCTGGGACG
AGAAAGGAGCCTGCCAGGGCTGCAGCATTTTATCGCAAGGCGGCTTCGCTAGGTGACACTCCAGCCATGTTCAAG
CTGGGCATGATTCTTCTTCAAGGATCTCTCGAACAGCCAAGAAATCCGCGCGAGGCTATTACATGGCTCAAACGC
GCCGCTGAACAGGCCGATGAAGACAACCCTCACGCACTGCATGAGCTGGGTGTTCTGCACGAACAGCCTAATTCA
AATATTGTGCCCTATGATCCTGGTTATGCTAAAGCCCTCTTTACGCAGGCAGCGCAACTGGGATACACTCAATCA
CAATACAAGCTCGGACAGTGCTACGAGTATGGTAATCTGGGCTGTCCAGTGGATCCTCGGCGGTCCATAGCTTGG
TACACCAAGGCGGCTGAAAAGGGCGATTCAGAAGCCGAGCTGGCACTGAGCGGCTGGTATCTTACGGGGAGCGAG
GGAGTGCTGAAGCAGAGTGATTCAGAGGCATACCTGTGGGCACGGCGCGCGGCTAACAAGGGGTTAAGTAAAGCC
GAGTACGCGGTGGGGTACTATGCCGAGGTGGGGATCGGGATCAAGCAGGACATGGAGTTTGCGAAAAAGTGGTAT
ATGCGAGCAGCAGCACAAGGGAACAAAAAGGCGATGAACCCGGCTGACGGAGTTGAAGCGGATGGGGAACAAGCG
AGCGCTGGGACGACCAACGCGGCAGGAGGCCAAGGACGAGTGTACGATTATCTCAACTGTCTCAACGAGGCAGAG
AACCACTCCCTCAAGAGCATCCTCCAACAAAAGTCAAAAAACTCGTCTGAAAATTACCTTTTCAGCGATGCAGAT
GCACAGCTCCTGCTCAACATTCATTTCAATCAAGCCGTGCGCATCCGCTCTCTCGCCATCACCTGCTCCGATCTC
TCTCAGGCACCCAAATCCATCAAGCTCGTCGTCAACAAACCTTCTTTAGGCTTTGAGGATGTGGAAAATGCCCAA
GACTCGCAGGTCGCGCAGGTTATTGAGCTGAAGGAGGATCAAGTCCGACATGGACAGCCGATTGCACTTCGATAT
GTGAGATTTCAAAGCGTCAACAGTCTGCATATCTTTGTCGAGTCTAATCATGGAGGAGGGGATGAAACCCGAATC
GATGCCATCGATATCTCTGGTTTTCCGATCGAAGCCACAAAGGACCTCAGCGGGTTGAAGAACACCGAATCTTAG
Gene >AgabiH97|059630
ATGAGTCGGTCGAATACTCCAGAACGCAGCAACTCGACCTCGCAGCTGAGAGACGAGTCTTGTCCTGCCTGTGTG
GAGGGTCAAACCCACGTTCTCAATGCGCTGGAAAAGGAGCGTTGGATCAGATGCGACGCCTGTAAAACATGGTAT
CATTGGCGCTGTGTTGGTCAAGGCGAGGACATTGATAGCATAGACAAATGGTGCGCCTGCTCTAGTTGTGCTCCT
TCGAACATACCGCTGAAATTCGTCACTAGGTTCTGTCAGAAATGCATCGAAGAAAAGCCTTCAAGGACTATCACC
CGTAAAGCTCCAGCCCGTAAATCCTCTCGTATCAAGACACAACGCGATTATGCGAGTTTGGATTCTGGTATCAGT
TTCGATCCTGCGCGGTGGTTGAGGATTCTGCAAGAGAAACGAACGGATGGAGATCCTTTTAGGCGAATGTATGGA
GGTGACCTTCGGTTGTCGTGGTTGGATGAAGATGAGATGGCTATGCGTGAACCTATCGTCATTGAAAAACCAGAG
GGGTTGGAGATAAAGATGCCGTCGAGTGATCTCACCGTGAATGAAATTGCCGAACTCGTTGGTAAGGATGTAGCT
GTAGAAGTCATTGGTGCGTTGCCCAGTTTTCTCATTCAGTCTTTTTTTTCCTCAACGACGCGTTAGATGTTGCTA
CTCAATCCACGTCACCGGGATGGACACTGGAAAAATGGGCAGAATATGTAGGATTGGAACCGGAGAAACGGGACA
AGATCCTCAACGTCATATCATTGGAAATATCGTCTACTAAATTAGCCGACATGATTGTGCCTCCTCGAATTGTGC
GGGAACTGGACTGGGTTGAAAACTTTTGGCCGAGTTCTCGTAAAGGCAAGGGGAATGTTTATCCCAAGGTTCAAT
TGTACTGTCTTATGGGGGTTGCCAATGCGTGGACGGTGCGTCCTTTTTGAAACATTCGATATCCGGTTCTGACTC
TTTACCATCAGGACTGGCACGTTGACTTTGCTGGTTCTTCGGTTTATTACCACATCTTGCACGGTTCCAAGGTGA
GTTAAGGATTTTCTTTCATTATTCGCATTACCACATTGGTTGTTCAGGTTTTCTACTTTATCCGACCGACGCCTG
CCAACCTAGCTGCTTATGAGCGGTGGTCGGGCACTGAATTGCAATATCAATCGTGGCTCGGAGACATGGTAGATG
AGGTATTTAAAGTAGAACTTGTGGAAGGAAACACTATGATAATTCCTTCTGGCTGGATACACGCCGTCGTATGTG
TTCCGCGAATAGTTTGCAGTATCGTACTCACTCGAAAGCAGTACACTCCGGTTGACACGATCGTGTTTGGAGGGA
ATTTTCTGCATTCTTATAGTGTTCCAACGCGTAAGTTGGCTTTTTATCGTTGGTTTGGAAAGCTTATTGGGCAAT
CAACCAGAGGTCCGGGTGCGTAATATTGAAATAGCGACGTCTGTACCCAAGAAATTCCGATTTCCGCATTTTGCC
AAGTACGTTATTGTTTTTTTTCCGTTAGTACGTTGTTGATGGTGATGTAGGTTGTGTTGGTATGTGGGAGAAAAG
TACCTTCGGGACGTGCGGTCCAATGGAGAGCACGAGTTTTCACCACGACTGCTTGGGTCGCTAACGGCGCTTGCG
GATTTTCTTGTGTCCGAAGCTCGGGTATTGGAGCATGGTGGGGAAACGGCGAAAAAGGAGGCTAGAGAGCAGATA
CCTACTGACCGAGTGAAAGATGGGCCTGCGGTGGCGAGAGAGCTTCGGTGGCGGCTACGACTGGCGAGTGGGTCT
GCCAGTGACGATGATAGCACACGGAGAGCGAATGGGCATGTGAATGGGGTGAAGAGACGGCGGGTGGAAGAGGAG
GGGTCGGAGGAAGGGTTGATGAGGTTTAGGAATTTTAAACCGCGTGTATGGGACCGGATTGAAGAGAGAGTGGAA
GAGGCGGTGAGTGAGTGTCGGGTGGGAGTGCGCCCTGGGGGTGAGGAGGGCTGGAGTGATGTGTGGGTGGGAACA
GAGGGGACGACGGCGGAGGGCGAAGAGGCACAGGTGAGCACACAGAAGACGGTGGTGGTAAAGGTGCGACGAGTG
GGAGGGGGTGTTGAGCGGCAACGGATTGAGCGTAGTGTAGAGAAGTGGACTTGGTAGAATTAGATTCACACACGC
TTGACAATGAACGTCCACCACGCCAACCACTCTGTGCCTACGCTCGACTCTCTTTCCTTGCACGAGCCTCCGTCC
AGAGCTGCCTCTTCCCTCGCTCACCACCCTCCTCCACGCCATGCTGCCACTCTTCCCGAGTTTCACGGCTACAAC
CCCCTCTATGCTGCTGCCTCTGATGTCCTCGGCATGGCCCCTCCTCCTCCTCCACCTGGTCCTCCCCCTCCTCCC
CTAGCGTACTCTCCCCACCCTCCCATGGGCCACTCCTTCAGCCCCTCTCCCTCCTCTTACGCCGGTTCTTATGAC
TCCTTCCCTCCTCCCTCCCTCTACCCACCTTCCGAAATCGAATCACGGCCTTCTCTGGAACGTTCAACGACCTTT
AAATCCGTCGCCCTCTCCTCCACCAAGAGCCGAGCAATCGATCTCACAACTCCCCCGTACACAAAAGACTACATT
GACCAGTACAGGCAACGGATAAAGGGGGACCCCGATCCAGAGGCACATTTCGCGTATGCCAAGTATCTCATAGAT
GCAGCAAAGCATATCCGTGCCGCCGCTCAGGACCAGAGGGCCGCGAGAAAGTACAGTGAGATTCTCATCCAAGAG
GCTCTCAAGGTTGTCAAACGGCTGGCTACTCAGGGTGAGGCATATCACGAAGCCCAGTTCTTTCTGGCAAATTGC
CATGGAACGGGCGCGTTGGGTCTTCAGGTCGACCATGAACGGGCATACCACCTCTATCTCCAGGCCGCCAAACAG
AACCACGCGCCCGCTTCGTATCGCGTGGCCGTGTGCAATGAAATCGGAGCTGGGACGAGAAAGGAGCCTGCCAGG
GCTGCAGCATTTTATCGCAAGGCGGCTTCGCTAGGTGACACTCCAGCCATGTTCAAGCTGGGCATGATTCTTCTT
CAAGGATCTCTCGAACAGCCAAGAAATCCGCGCGAGGCTATTACATGGCTCAAACGCGCCGCTGAACAGGCCGAT
GAAGACAACCCTCACGCACTGCATGAGCTGGGTGTTCTGCACGAACAGCCTAATTCAAATATTGTGCCCTATGAT
CCTGGTTATGCTAAAGCCCTCTTTACGCAGGCAGCGCAACTGGGATACACTCAATCACAATACAAGCTCGGACAG
TGCTACGAGTATGGTAATCTGGGCTGTCCAGTGGATCCTCGGCGGTCCATAGCTTGGTACACCAAGGCGGCTGAA
AAGGGCGATTCAGAAGCCGAGCTGGCACTGAGCGGCTGGTATCTTACGGGGAGCGAGGGAGTGCTGAAGCAGAGT
GATTCAGAGGCATACCTGTGGGCACGGCGCGCGGCTAACAAGGGGTTAAGTAAAGCCGAGTACGCGGTGGGGTAC
TATGCCGAGGTGGGGATCGGGATCAAGCAGGACATGGAGTTTGCGAAAAAGTGGTATATGCGAGCAGCAGGTACG
TGCGTTGGATGTCGAGACTGACGCTGAACTCATCCGTCCACAGCACAAGGGAACAAAAAGGCGATGAACCCGGCT
GACGGAGTTGAAGCGGATGGGGAACAAGCGAGCGCTGGGACGACCAACGCGGCAGGAGGCCAAGGACGAGTGTAC
GATTATGTAATGTTCCAATGCTTAGCGTAGACCAACAACAGCCGCCGTCCCTGCTCGAGTTTCTCGACGTCTCCC
AGCTCAACTGTCTCAACGAGGCAGAGAACCACTCCCTCAAGAGCATCCTCCAACAAAAGTCAAAAAACTCGTCTG
AAAATTACCTTTTCAGCGATGCAGATGCACAGCTCCTGCTCAACATTCATGTATGTCCAACCCCCCAACTCCCCT
CTCCGTTCTCCCCGTCCCAGCTTGTCGTACGTATAGTTCAATCAAGCCGTGCGCATCCGCTCTCTCGCCATCACC
TGCTCCGATCTCTCTCAGGCACCCAAATCCATCAAGCTCGTCGTCAACAAACCTTCTTTAGGCTTTGAGGATGTG
GAAAATGCCCAAGACTCGCAGGTCGCGCAGGTTATTGAGCTGAAGGAGGATCAAGTCCGACATGGACAGCCGATT
GCACTTCGATATGTGAGATTTCAAAGCGTCAACAGTCTGCATGTATGTTGGGTCCTACTCAGTGGTGCCGTACTC
CCCTTGCTTAAGTACAAACAGATCTTTGTCGAGTCTAATCATGGAGGAGGGGATGAAACCCGAATCGATGCCATC
GATATCTCTGGTTTTCCGATCGAGTGAGCGCTTTTGTCTTGTAGACCAAGGGTCCAACCATTCATTGTATTTTAG
AGCCACAAAGGACCTCAGCGGGTTGAAGAACACCGAATCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail