Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059560
Gene name
Locationscaffold_3:1659580..1660255
Strand-
Gene length (bp)675
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03371 PRP38 PRP38 family 3.8E-14 10 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RDD2|PR38A_PONAB Pre-mRNA-splicing factor 38A OS=Pongo abelii GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q8HXH6|PR38A_MACFA Pre-mRNA-splicing factor 38A OS=Macaca fascicularis GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q8NAV1|PR38A_HUMAN Pre-mRNA-splicing factor 38A OS=Homo sapiens GN=PRPF38A PE=1 SV=1 1 68 3.0E-23
sp|Q0P5I6|PR38A_BOVIN Pre-mRNA-splicing factor 38A OS=Bos taurus GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q4FK66|PR38A_MOUSE Pre-mRNA-splicing factor 38A OS=Mus musculus GN=Prpf38a PE=1 SV=1 1 68 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RDD2|PR38A_PONAB Pre-mRNA-splicing factor 38A OS=Pongo abelii GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q8HXH6|PR38A_MACFA Pre-mRNA-splicing factor 38A OS=Macaca fascicularis GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q8NAV1|PR38A_HUMAN Pre-mRNA-splicing factor 38A OS=Homo sapiens GN=PRPF38A PE=1 SV=1 1 68 3.0E-23
sp|Q0P5I6|PR38A_BOVIN Pre-mRNA-splicing factor 38A OS=Bos taurus GN=PRPF38A PE=2 SV=1 1 68 3.0E-23
sp|Q4FK66|PR38A_MOUSE Pre-mRNA-splicing factor 38A OS=Mus musculus GN=Prpf38a PE=1 SV=1 1 68 9.0E-23
sp|Q28H87|PR38A_XENTR Pre-mRNA-splicing factor 38A OS=Xenopus tropicalis GN=prpf38a PE=2 SV=1 1 68 1.0E-22
sp|Q4FZQ6|PR38A_XENLA Pre-mRNA-splicing factor 38A OS=Xenopus laevis GN=prpf38a PE=2 SV=1 1 68 1.0E-22
sp|Q6DHU4|PR38A_DANRE Pre-mRNA-splicing factor 38A OS=Danio rerio GN=prpf38a PE=2 SV=1 1 68 1.0E-22
sp|Q8LB54|PRP38_ARATH Pre-mRNA-splicing factor 38 OS=Arabidopsis thaliana GN=PRP38 PE=1 SV=1 1 63 1.0E-17
sp|Q9UUD2|PRP38_SCHPO Pre-mRNA-splicing factor 38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp38 PE=3 SV=1 10 77 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059560
MANTTVIGAKAIHGQNPQYLVETVIRSRIYECTFWKEHCFALTAATIIDKSIELRTIGGVYGARKGNITGISPSR
RIQVSTCFGRNVHTDDLSSRRRLRDSRTSPKRLQETAPAGDEWILVDIHGRVCQRTFDRGTCM*
Coding >AgabiH97|059560
ATGGCCAATACGACAGTCATTGGTGCCAAAGCCATCCACGGCCAGAACCCCCAGTATTTAGTGGAGACTGTCATT
CGCAGTCGCATCTACGAATGCACGTTCTGGAAGGAACATTGCTTTGCACTCACCGCCGCCACCATCATAGACAAA
TCAATCGAATTGCGCACGATAGGTGGTGTCTATGGAGCCAGAAAAGGAAATATTACTGGAATATCTCCAAGCAGA
CGAATTCAAGTATCTACGTGCTTTGGCCGCAATGTACATACGGATGACCTTTCGAGCCGTCGACGTCTACGAGAT
TCTAGAACCTCTCCTAAAAGACTACAGGAAACTGCGCCAGCGGGGGATGAATGGATACTCGTTGACATACATGGA
CGAGTTTGTCAACGAACTTTTGACAGAGGAACGTGTATGTGA
Transcript >AgabiH97|059560
ATGGCCAATACGACAGTCATTGGTGCCAAAGCCATCCACGGCCAGAACCCCCAGTATTTAGTGGAGACTGTCATT
CGCAGTCGCATCTACGAATGCACGTTCTGGAAGGAACATTGCTTTGCACTCACCGCCGCCACCATCATAGACAAA
TCAATCGAATTGCGCACGATAGGTGGTGTCTATGGAGCCAGAAAAGGAAATATTACTGGAATATCTCCAAGCAGA
CGAATTCAAGTATCTACGTGCTTTGGCCGCAATGTACATACGGATGACCTTTCGAGCCGTCGACGTCTACGAGAT
TCTAGAACCTCTCCTAAAAGACTACAGGAAACTGCGCCAGCGGGGGATGAATGGATACTCGTTGACATACATGGA
CGAGTTTGTCAACGAACTTTTGACAGAGGAACGTGTATGTGA
Gene >AgabiH97|059560
ATGGCCAATACGACAGTCATTGGTGCCAAAGCCATCCACGGCCAGAACCCCCAGGTAAGAGTCTGGTCCATTCGT
TTAGCTTTCACCAATTCCCTAATTTCGACAGTATTTAGTGGAGACTGTCATTCGCAGTCGCATCTACGAATGCAC
GTTCTGGAAGGAACATTGCTTTGCACTCACCGGTATGACTACGGCCCGCACCTTCTCTAACTCAATCTCATACCT
CGCACAGCCGCCACCATCATAGACAAATCAATCGAATTGCGCACGATAGGTGGTGTCTATGGAGGTAACCAGAAA
CCGACAGACTTTCTTTGTCTTCTCCTCAAGCTTCTACAAATCCAGCCAGAAAAGGAAATATTACTGGAATATCTC
CAAGCAGACGAATTCAAGTATGTGTCGTTTATTTACAAAATTTTCCCCAGTACCTATGTCCTTATAGGTATCTAC
GTGCTTTGGCCGCAATGTACATACGGATGACCTTTCGAGCCGTCGACGTCTACGAGATTCTAGAACCTCTCCTAA
AAGACTACAGGAAACTGCGCCAGCGGGGGATGAGTGAGTACTGATGGTCCTTGTCGAGATATGTATGAACCTGAT
CCTTCTAGATGGATACTCGTTGACATACATGGACGAGTTTGTCAACGAACTTTTGACAGAGGAACGTGTATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail