Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059450
Gene name
Locationscaffold_3:1633088..1633992
Strand-
Gene length (bp)904
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11788 MRP-L46 39S mitochondrial ribosomal protein L46 9.0E-20 24 130
PF00293 NUDIX NUDIX domain 3.9E-07 147 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 23 267 4.0E-28
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 26 267 4.0E-24
sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 4 268 1.0E-17
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 3 268 2.0E-16
sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 4 268 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 23 267 4.0E-28
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 26 267 4.0E-24
sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 4 268 1.0E-17
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 3 268 2.0E-16
sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 4 268 1.0E-15
sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=1 SV=1 27 267 1.0E-15
sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 4 268 2.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059450
MLRALSSRSRAFATEAPRRPVKPRLSAAIVLNRSPILTPSPTPFEKAYYAYQARIRRALHQPFPYDFYFKQGSLL
ETRYNLEEKDREQAAFGPTYAQDDYQDQAKEEADKAAVKLLAQQEGEGESLAPREHPSDKSGDVKSLDRAGERNL
YLLLRSRDGDRDLWRFPQGGIEKGDFLHQAAQKDLEAECGEYMDTWVVSRNPIGVYKPPQPDPSTPEHVVFFYKA
HIMAGQVQPAEGIQDFAWLTKQEIEQRVDKEYWQNVKDMLSDF*
Coding >AgabiH97|059450
ATGCTGCGCGCCCTCTCCTCGCGCTCGAGGGCCTTTGCCACAGAGGCTCCTCGCCGGCCCGTCAAGCCCCGTCTG
TCAGCAGCCATCGTCCTCAACCGCTCGCCCATCCTCACCCCCTCTCCAACCCCCTTTGAAAAAGCCTATTACGCC
TACCAAGCCCGCATTCGTCGCGCCCTCCACCAGCCCTTTCCCTATGACTTTTATTTCAAACAGGGCTCTCTGCTA
GAGACACGCTATAACCTCGAAGAAAAAGACAGAGAGCAAGCTGCTTTCGGTCCCACCTATGCGCAGGATGACTAC
CAGGACCAGGCAAAGGAAGAAGCAGACAAGGCTGCCGTCAAGCTGCTAGCTCAGCAGGAGGGCGAGGGCGAGTCT
TTGGCTCCAAGAGAACATCCCTCAGACAAGTCAGGAGACGTTAAAAGTCTCGACAGGGCAGGAGAGCGCAACCTT
TATCTTCTTCTAAGGTCGAGAGACGGTGATAGAGACCTATGGCGCTTTCCTCAAGGAGGAATTGAAAAGGGTGAC
TTTTTGCACCAGGCTGCCCAAAAAGACCTCGAAGCCGAGTGTGGAGAGTATATGGACACCTGGGTAGTCAGTCGA
AATCCCATTGGCGTTTACAAGCCCCCTCAGCCCGATCCATCTACCCCCGAGCATGTCGTATTTTTCTACAAAGCT
CATATAATGGCCGGCCAAGTGCAACCAGCAGAAGGCATTCAAGATTTTGCATGGCTAACAAAACAAGAGATTGAA
CAACGAGTCGACAAGGAGTATTGGCAAAACGTAAAGGATATGCTCTCAGACTTCTGA
Transcript >AgabiH97|059450
ATGCTGCGCGCCCTCTCCTCGCGCTCGAGGGCCTTTGCCACAGAGGCTCCTCGCCGGCCCGTCAAGCCCCGTCTG
TCAGCAGCCATCGTCCTCAACCGCTCGCCCATCCTCACCCCCTCTCCAACCCCCTTTGAAAAAGCCTATTACGCC
TACCAAGCCCGCATTCGTCGCGCCCTCCACCAGCCCTTTCCCTATGACTTTTATTTCAAACAGGGCTCTCTGCTA
GAGACACGCTATAACCTCGAAGAAAAAGACAGAGAGCAAGCTGCTTTCGGTCCCACCTATGCGCAGGATGACTAC
CAGGACCAGGCAAAGGAAGAAGCAGACAAGGCTGCCGTCAAGCTGCTAGCTCAGCAGGAGGGCGAGGGCGAGTCT
TTGGCTCCAAGAGAACATCCCTCAGACAAGTCAGGAGACGTTAAAAGTCTCGACAGGGCAGGAGAGCGCAACCTT
TATCTTCTTCTAAGGTCGAGAGACGGTGATAGAGACCTATGGCGCTTTCCTCAAGGAGGAATTGAAAAGGGTGAC
TTTTTGCACCAGGCTGCCCAAAAAGACCTCGAAGCCGAGTGTGGAGAGTATATGGACACCTGGGTAGTCAGTCGA
AATCCCATTGGCGTTTACAAGCCCCCTCAGCCCGATCCATCTACCCCCGAGCATGTCGTATTTTTCTACAAAGCT
CATATAATGGCCGGCCAAGTGCAACCAGCAGAAGGCATTCAAGATTTTGCATGGCTAACAAAACAAGAGATTGAA
CAACGAGTCGACAAGGAGTATTGGCAAAACGTAAAGGATATGCTCTCAGACTTCTGA
Gene >AgabiH97|059450
ATGCTGCGCGCCCTCTCCTCGCGCTCGAGGGCCTTTGCCACAGAGGCTCCTCGCCGGCCCGTCAAGCCCCGTCTG
TCAGCAGCCATCGTCCTCAACCGCTCGCCCATCCTCACCCCCTCTCCAACCCCCTTTGAAAAAGCCTATTACGCC
TACCAAGCCCGCATTCGTCGCGCCCTCCACCAGCCCTTTCCCTATGACTTTTATTTCAAACAGGGCTCTCTGCTA
GAGACACGCTATAACCTCGAAGAAAAAGACAGAGAGCAAGCTGCTTTCGGTCCCACCTATGCGCAGGATGACTAC
CAGGACCAGGCAAAGGAAGAAGCAGACAAGGCTGCCGTCAAGCTGCTAGCTCAGCAGGAGGGCGAGGGCGAGTCT
TTGGCTCCAAGAGAACATCCCTCAGACAAGTCAGGAGACGTTAAAAGTCTCGACAGGGCAGGAGAGCGCAACCTT
TATCTTCTTCTAAGGTCGAGAGACGGTGATAGAGACCTATGGCGCTTTCCTCAAGGAGGAATTGAAAAGGGTGAC
TTTTTGCACCAGGTCGGTCATCACTTCAGGGACCGCTCTGCCAATGCTGATAATCCCTCTCAGGCTGCCCAAAAA
GACCTCGAAGCCGAGTGTGGAGAGTATATGGACACCTGGGTAGTCAGTCGAAATCCCATTGGCGTTTACAAGCCC
CCTCAGCCCGATCCATCTACCCCCGAGGTATGCCTTGATAACTCATAGTAGCAAATAACTAACACTTCTACAGCA
TGTCGTATTTTTCTACAAAGCTCATATAATGGCCGGCCAAGTGCAACCAGCAGAAGGCATTCAAGATTTTGCATG
GCTAACAAAACAAGAGATTGAACAACGAGTCGACAAGGAGTATTGGCAAAACGTAAAGGATATGCTCTCAGACTT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail