Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059370
Gene name
Locationscaffold_3:1618447..1619803
Strand-
Gene length (bp)1356
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06391 MAT1 CDK-activating kinase assembly factor MAT1 2.9E-57 111 309
PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger) 9.6E-23 61 107
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.4E-04 64 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 55 358 3.0E-57
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 62 358 3.0E-56
sp|O94684|TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmh1 PE=1 SV=1 60 359 4.0E-56
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 62 358 2.0E-54
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 62 358 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 55 358 3.0E-57
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 62 358 3.0E-56
sp|O94684|TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmh1 PE=1 SV=1 60 359 4.0E-56
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 62 358 2.0E-54
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 62 358 2.0E-54
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 62 358 6.0E-53
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 62 358 2.0E-52
sp|P51951|MAT1_XENLA CDK-activating kinase assembly factor MAT1 OS=Xenopus laevis GN=mnat1 PE=2 SV=1 60 358 5.0E-50
sp|P51949|MAT1_MOUSE CDK-activating kinase assembly factor MAT1 OS=Mus musculus GN=Mnat1 PE=1 SV=2 60 362 5.0E-49
sp|P51948|MAT1_HUMAN CDK-activating kinase assembly factor MAT1 OS=Homo sapiens GN=MNAT1 PE=1 SV=1 60 362 3.0E-48
sp|P51950|MAT1_MARGL CDK-activating kinase assembly factor MAT1 OS=Marthasterias glacialis PE=1 SV=1 60 263 1.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4688 0.8438 0.008 0.0136 0.099 0.002 0.0518 0.0726 0.095 0.0044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 34.14 19.43 48.84
Initials Initials knots 31.00 17.58 44.41
Pileal_Stipeal_center Stage I stipe center 40.27 23.50 57.03
Pileal_Stipeal_shell Stage I stipe shell 59.59 35.56 83.63
DIF_stipe_center Stage II stipe center 40.06 23.40 56.71
DIF_stipe_shell Stage II stipe shell 52.68 31.36 74.00
DIF_stipe_skin Stage II stipe skin 55.57 33.21 77.94
DIF_cap_skin Stage II cap skin 65.05 39.10 90.99
DIF_cap_tissue Stage II cap tissue 59.36 35.66 83.06
DIF_gill_tissue Stage II gill tissue 52.18 30.88 73.48
YFB_stipe_center Young fruiting body stipe center 42.89 25.34 60.44
YFB_stipe_shell Young fruiting body stipe shell 48.75 28.97 68.54
YFB_stipe_skin Young fruiting body stipe skin 66.34 39.71 92.98
YFB_cap_skin Young fruiting body cap skin 74.53 45.05 104.01
YFB_cap_tissue Young fruiting body cap tissue 59.01 35.49 82.53
YFB_gill_tissue Young fruiting body gill tissue 62.54 37.61 87.47
YFB_veil Young fruiting body veil 60.49 36.41 84.57

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.161831 no
Casing YFB_stipe_center 0.548713 no
Casing YFB_stipe_shell 0.253470 no
Casing YFB_stipe_skin 0.013186 yes
Casing YFB_cap_skin 0.003365 yes
Casing YFB_cap_tissue 0.047584 yes
Casing YFB_gill_tissue 0.025458 yes
Casing YFB_veil 0.037364 yes
Casing Initials 0.852043 no
Casing Pileal_Stipeal_center 0.697309 no
Casing Pileal_Stipeal_shell 0.044201 yes
Casing DIF_stipe_center 0.707856 no
Casing DIF_stipe_shell 0.139707 no
Casing DIF_stipe_skin 0.091161 no
Casing DIF_cap_skin 0.017226 yes
Casing DIF_cap_tissue 0.044418 yes
DIF_gill_tissue YFB_stipe_center 0.623113 no
DIF_gill_tissue YFB_stipe_shell 0.895427 no
DIF_gill_tissue YFB_stipe_skin 0.508091 no
DIF_gill_tissue YFB_cap_skin 0.246090 no
DIF_gill_tissue YFB_cap_tissue 0.782541 no
DIF_gill_tissue YFB_gill_tissue 0.651906 no
DIF_gill_tissue YFB_veil 0.730460 no
YFB_stipe_center YFB_stipe_shell 0.775268 no
YFB_stipe_center YFB_stipe_skin 0.135743 no
YFB_stipe_center YFB_cap_skin 0.043339 yes
YFB_stipe_center YFB_cap_tissue 0.317155 no
YFB_stipe_center YFB_gill_tissue 0.216647 no
YFB_stipe_center YFB_veil 0.273153 no
YFB_stipe_shell YFB_stipe_skin 0.338227 no
YFB_stipe_shell YFB_cap_skin 0.136602 no
YFB_stipe_shell YFB_cap_tissue 0.612840 no
YFB_stipe_shell YFB_gill_tissue 0.471961 no
YFB_stipe_shell YFB_veil 0.554686 no
YFB_stipe_skin YFB_cap_skin 0.788198 no
YFB_stipe_skin YFB_cap_tissue 0.789600 no
YFB_stipe_skin YFB_gill_tissue 0.908823 no
YFB_stipe_skin YFB_veil 0.843856 no
YFB_cap_skin YFB_cap_tissue 0.501761 no
YFB_cap_skin YFB_gill_tissue 0.653561 no
YFB_cap_skin YFB_veil 0.565027 no
YFB_cap_tissue YFB_gill_tissue 0.912527 no
YFB_cap_tissue YFB_veil 0.964708 no
YFB_gill_tissue YFB_veil 0.952086 no
Initials DIF_gill_tissue 0.078236 no
Initials YFB_stipe_center 0.343537 no
Initials YFB_stipe_shell 0.133144 no
Initials YFB_stipe_skin 0.003765 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.015242 yes
Initials YFB_gill_tissue 0.009773 yes
Initials YFB_veil 0.012880 yes
Initials Pileal_Stipeal_center 0.476299 no
Initials Pileal_Stipeal_shell 0.014081 yes
Initials DIF_stipe_center 0.486372 no
Initials DIF_stipe_shell 0.062610 no
Initials DIF_stipe_skin 0.039612 yes
Initials DIF_cap_skin 0.005671 yes
Initials DIF_cap_tissue 0.016104 yes
Pileal_Stipeal_center DIF_gill_tissue 0.466733 no
Pileal_Stipeal_center YFB_stipe_center 0.905242 no
Pileal_Stipeal_center YFB_stipe_shell 0.623687 no
Pileal_Stipeal_center YFB_stipe_skin 0.073949 no
Pileal_Stipeal_center YFB_cap_skin 0.020523 yes
Pileal_Stipeal_center YFB_cap_tissue 0.199136 no
Pileal_Stipeal_center YFB_gill_tissue 0.127052 no
Pileal_Stipeal_center YFB_veil 0.165164 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.194246 no
Pileal_Stipeal_center DIF_stipe_center 0.992693 no
Pileal_Stipeal_center DIF_stipe_shell 0.430182 no
Pileal_Stipeal_center DIF_stipe_skin 0.316421 no
Pileal_Stipeal_center DIF_cap_skin 0.090658 no
Pileal_Stipeal_center DIF_cap_tissue 0.192167 no
Pileal_Stipeal_shell DIF_gill_tissue 0.764358 no
Pileal_Stipeal_shell YFB_stipe_center 0.307094 no
Pileal_Stipeal_shell YFB_stipe_shell 0.598330 no
Pileal_Stipeal_shell YFB_stipe_skin 0.817138 no
Pileal_Stipeal_shell YFB_cap_skin 0.532438 no
Pileal_Stipeal_shell YFB_cap_tissue 0.985371 no
Pileal_Stipeal_shell YFB_gill_tissue 0.930180 no
Pileal_Stipeal_shell YFB_veil 0.978782 no
Pileal_Stipeal_shell DIF_stipe_center 0.176682 no
Pileal_Stipeal_shell DIF_stipe_shell 0.780407 no
Pileal_Stipeal_shell DIF_stipe_skin 0.891462 no
Pileal_Stipeal_shell DIF_cap_skin 0.858214 no
Pileal_Stipeal_shell DIF_cap_tissue 0.994143 no
DIF_stipe_center DIF_gill_tissue 0.454917 no
DIF_stipe_center YFB_stipe_center 0.894880 no
DIF_stipe_center YFB_stipe_shell 0.608145 no
DIF_stipe_center YFB_stipe_skin 0.069952 no
DIF_stipe_center YFB_cap_skin 0.019442 yes
DIF_stipe_center YFB_cap_tissue 0.194246 no
DIF_stipe_center YFB_gill_tissue 0.124559 no
DIF_stipe_center YFB_veil 0.162096 no
DIF_stipe_center DIF_stipe_shell 0.420349 no
DIF_stipe_center DIF_stipe_skin 0.310490 no
DIF_stipe_center DIF_cap_skin 0.085898 no
DIF_stipe_center DIF_cap_tissue 0.186180 no
DIF_stipe_shell DIF_gill_tissue 0.986481 no
DIF_stipe_shell YFB_stipe_center 0.586018 no
DIF_stipe_shell YFB_stipe_shell 0.873374 no
DIF_stipe_shell YFB_stipe_skin 0.517974 no
DIF_stipe_shell YFB_cap_skin 0.252836 no
DIF_stipe_shell YFB_cap_tissue 0.797303 no
DIF_stipe_shell YFB_gill_tissue 0.664562 no
DIF_stipe_shell YFB_veil 0.742323 no
DIF_stipe_shell DIF_stipe_skin 0.918159 no
DIF_stipe_shell DIF_cap_skin 0.563828 no
DIF_stipe_shell DIF_cap_tissue 0.786598 no
DIF_stipe_skin DIF_gill_tissue 0.903038 no
DIF_stipe_skin YFB_stipe_center 0.462958 no
DIF_stipe_skin YFB_stipe_shell 0.763457 no
DIF_stipe_skin YFB_stipe_skin 0.652922 no
DIF_stipe_skin YFB_cap_skin 0.362309 no
DIF_stipe_skin YFB_cap_tissue 0.907101 no
DIF_stipe_skin YFB_gill_tissue 0.790663 no
DIF_stipe_skin YFB_veil 0.860405 no
DIF_stipe_skin DIF_cap_skin 0.701519 no
DIF_stipe_skin DIF_cap_tissue 0.896523 no
DIF_cap_skin DIF_gill_tissue 0.558353 no
DIF_cap_skin YFB_stipe_center 0.159859 no
DIF_cap_skin YFB_stipe_shell 0.386814 no
DIF_cap_skin YFB_stipe_skin 0.972098 no
DIF_cap_skin YFB_cap_skin 0.746576 no
DIF_cap_skin YFB_cap_tissue 0.835415 no
DIF_cap_skin YFB_gill_tissue 0.943459 no
DIF_cap_skin YFB_veil 0.884202 no
DIF_cap_skin DIF_cap_tissue 0.847700 no
DIF_cap_tissue DIF_gill_tissue 0.771411 no
DIF_cap_tissue YFB_stipe_center 0.309546 no
DIF_cap_tissue YFB_stipe_shell 0.601101 no
DIF_cap_tissue YFB_stipe_skin 0.808012 no
DIF_cap_tissue YFB_cap_skin 0.515779 no
DIF_cap_tissue YFB_cap_tissue 0.991015 no
DIF_cap_tissue YFB_gill_tissue 0.922075 no
DIF_cap_tissue YFB_veil 0.972996 no

Orthologs

Orthofinder run ID1
Orthogroup4060
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|059370
Agaricus bisporus var bisporus H97 AgabiH97|059370 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|12_68

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059370
MTSRNNVGGWLRGKTIKKAGAASSSNTRSSTPQQVQSTSTTVFGGGVKDPSGRVSEFFSMDDQCPVCKSDRYLNP
KLRLLVSSCYHKMCESCIDRLFTLGPAPCPICNKILRKLAFTPQTFEDLGVEKEVAVRRRIAKEFNKRREDFPDL
RFYNDYLEEVEDITFNLINDIDITETEARVARYRLENSALIELNLQREEAYVQQLRDQEETERREREARAQELRR
EEEEEREEREKGKREIIDKLETSNKDAAKVVAKTRANALKRSQARSSSASQLMSSSRLLRSRAAQSTNVPDVPHV
PLQDNYYAYEGKFVLRPEGYLDFLSEAVRKDREGIMRGGGYKVEEAWERALRSAVAALDLPPLSGLPNQTSQSEQ
EGDVVMVS*
Coding >AgabiH97|059370
ATGACTTCTCGAAATAACGTCGGAGGCTGGCTTCGGGGAAAGACAATTAAGAAAGCTGGGGCCGCTTCGTCTAGC
AACACGCGTTCTTCTACCCCACAGCAAGTACAAAGCACTTCAACGACCGTATTCGGAGGGGGTGTCAAAGACCCA
TCAGGAAGAGTATCAGAATTTTTCTCAATGGACGACCAGTGTCCTGTTTGTAAGAGCGACCGATATCTCAATCCT
AAGCTTCGCCTGCTGGTAAGCTCATGCTACCACAAAATGTGTGAGTCATGCATTGACAGACTATTCACACTGGGG
CCAGCGCCTTGTCCTATCTGCAATAAAATCCTCCGAAAGCTTGCGTTTACACCACAGACTTTCGAAGACCTCGGA
GTCGAGAAGGAAGTGGCTGTAAGACGACGGATAGCAAAAGAATTTAACAAAAGGAGGGAAGATTTTCCAGATCTT
CGATTCTACAACGATTACCTGGAGGAGGTTGAAGACATTACCTTCAACCTCATCAATGATATCGACATTACGGAG
ACAGAGGCTCGGGTGGCAAGATATCGTTTGGAAAATTCCGCGCTTATAGAACTCAATCTGCAGCGTGAGGAAGCT
TACGTTCAGCAACTTCGCGACCAAGAAGAGACAGAACGTCGAGAACGTGAAGCGAGAGCACAAGAACTTCGACGA
GAAGAAGAAGAGGAACGAGAGGAACGAGAAAAGGGCAAGCGAGAAATCATTGACAAACTGGAGACCAGTAACAAA
GACGCCGCTAAAGTCGTGGCTAAAACGCGCGCGAATGCACTCAAGCGCAGCCAAGCTCGCTCCTCCTCTGCTTCA
CAACTTATGAGCAGCTCGAGGTTGTTAAGGTCAAGAGCAGCACAAAGTACAAACGTGCCCGATGTGCCTCATGTC
CCACTGCAAGACAACTATTATGCTTATGAAGGCAAATTCGTGCTGCGACCTGAAGGATATCTTGATTTTCTAAGT
GAGGCTGTCAGAAAGGACAGGGAAGGAATCATGCGCGGAGGGGGTTACAAAGTCGAAGAGGCATGGGAGCGGGCT
CTCCGCAGCGCCGTCGCTGCTCTTGACCTTCCACCTCTATCGGGACTCCCTAATCAGACATCCCAATCAGAACAG
GAGGGAGATGTAGTCATGGTATCATAG
Transcript >AgabiH97|059370
ATGACTTCTCGAAATAACGTCGGAGGCTGGCTTCGGGGAAAGACAATTAAGAAAGCTGGGGCCGCTTCGTCTAGC
AACACGCGTTCTTCTACCCCACAGCAAGTACAAAGCACTTCAACGACCGTATTCGGAGGGGGTGTCAAAGACCCA
TCAGGAAGAGTATCAGAATTTTTCTCAATGGACGACCAGTGTCCTGTTTGTAAGAGCGACCGATATCTCAATCCT
AAGCTTCGCCTGCTGGTAAGCTCATGCTACCACAAAATGTGTGAGTCATGCATTGACAGACTATTCACACTGGGG
CCAGCGCCTTGTCCTATCTGCAATAAAATCCTCCGAAAGCTTGCGTTTACACCACAGACTTTCGAAGACCTCGGA
GTCGAGAAGGAAGTGGCTGTAAGACGACGGATAGCAAAAGAATTTAACAAAAGGAGGGAAGATTTTCCAGATCTT
CGATTCTACAACGATTACCTGGAGGAGGTTGAAGACATTACCTTCAACCTCATCAATGATATCGACATTACGGAG
ACAGAGGCTCGGGTGGCAAGATATCGTTTGGAAAATTCCGCGCTTATAGAACTCAATCTGCAGCGTGAGGAAGCT
TACGTTCAGCAACTTCGCGACCAAGAAGAGACAGAACGTCGAGAACGTGAAGCGAGAGCACAAGAACTTCGACGA
GAAGAAGAAGAGGAACGAGAGGAACGAGAAAAGGGCAAGCGAGAAATCATTGACAAACTGGAGACCAGTAACAAA
GACGCCGCTAAAGTCGTGGCTAAAACGCGCGCGAATGCACTCAAGCGCAGCCAAGCTCGCTCCTCCTCTGCTTCA
CAACTTATGAGCAGCTCGAGGTTGTTAAGGTCAAGAGCAGCACAAAGTACAAACGTGCCCGATGTGCCTCATGTC
CCACTGCAAGACAACTATTATGCTTATGAAGGCAAATTCGTGCTGCGACCTGAAGGATATCTTGATTTTCTAAGT
GAGGCTGTCAGAAAGGACAGGGAAGGAATCATGCGCGGAGGGGGTTACAAAGTCGAAGAGGCATGGGAGCGGGCT
CTCCGCAGCGCCGTCGCTGCTCTTGACCTTCCACCTCTATCGGGACTCCCTAATCAGACATCCCAATCAGAACAG
GAGGGAGATGTAGTCATGGTATCATAG
Gene >AgabiH97|059370
ATGACTTCTCGAAATAACGTCGGAGGCTGGCTTCGGGGAAAGACAATTAAGAAAGCTGGGGCCGCTTCGTCTAGC
AACACGCGTTCTTCTACCCCACAGCAAGTACAAAGCACTTCAACGACCGTATTCGGAGGGGGTGTCAAAGACCCA
TCAGGAAGAGTATCAGAATTTTTCGTGAGTTGCATACACTTGCACCCTCCACGCGACTTATATTGTGGTAGTCAA
TGGACGACCAGTGTCCTGTTTGTAAGAGCGACCGATATCTCAATCCTAAGCTTCGCCTGCTGGTAAGCTCATGCT
ACCACAAAATGTATGTATGTAGACTGCGCCTCCAATCCAATTGAATGAAGCTAATATATTCAGGTGTGAGTCATG
CATTGACAGACTATTCACACTGGGGCCAGCGCCTTGTCCTATCTGCAATAAAATCCTCCGAAAGCTTGCGTTTAC
ACCACAGACTTTCGAAGACCTCGGAGTCGAGAAGGAAGTGGCTGTAAGACGACGGATAGCAAAAGAGTGTGTTGC
TTATCTCATTACATGTTCTGCCCATTTACCGTTTGATTTAGATTTAACAAAAGGAGGGAAGATTTTCCAGATCTT
CGATTCTACAACGATTACCTGGAGGAGGTTGAAGACATTAGTAAGTCTCCCTACTCAATCATCATGGTATTGAAA
TGGCTAATTTGTGCGTTAGCCTTCAACCTCATCAATGATATCGACATTACGGAGACAGAGGCTCGGGTGGCAAGA
TATCGTTTGGAAAATTCCGCGCTTATAGAACTCAATCTGCAGCGTGAGGAAGCTTACGTTCAGCAACTTCGCGAC
CAAGAAGAGACAGAACGTCGAGAACGTGAAGCGAGAGCACAAGAACTTCGACGAGAAGAAGAAGAGGAACGAGAG
GAACGAGAAAAGGGCAAGCGAGAAATCATTGACAAACTGGAGACCAGTAACAAAGACGCCGCTAAAGTCGTGGCT
AAAACGCGCGCGAATGCACTCAAGCGCAGCCAAGCTCGCTCCTCCTCTGCTTCACAACTTATGAGCAGCTCGAGG
TTGTTAAGGTCAAGAGCAGCACAAAGTACAAACGTGCCCGATGTGCCTCATGTCCCACTGCAAGACAACTATTAT
GCTTATGAAGGCAAATTCGTGCTGCGACCTGAAGGATATCTTGATTTTCTAAGTGAGGCTGTCAGAAAGGACAGG
GAAGGAATCATGCGCGGAGGGGGTTACAAAGTCGAAGAGGCATGGGAGCGGGCTCTCCGCAGCGCCGTCGCTGCT
CTTGACCTTCCACCTCTATCGGGACTCCCTAATCAGACATCCCAATCAGAACAGGAGGGAGATGTAGTCATGGTA
TCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail