Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059320
Gene name
Locationscaffold_3:1605934..1607811
Strand+
Gene length (bp)1877
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.8E-04 172 242

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059320
MANKPSAIIFGGLNTCSRALASYLVPLEGEPLVSHLRIIDKYSVVPATTYIGSEFPKLLEKPQVEYRQVNLTVPE
KIPPVFEPPAGIPPFEYVFDFTGEIWADRSEEIIINFTCHTAKLIGEEAARRKVKAYVRIHQPYYKVSGKVPQDE
NSQVQPWGTIGTWWHETLRILGAIEGLNLVILRPGFVYGPYTNYGIIASAIVIASVYGHLHKPMKSMWSPGKNIT
YTVHVEDVAGAAWAAAHWIAQLGRQAADEKAGVEIVSYAPQTTQSPELIPKNQKVIAPVFNVTDDSNSTHLSVGQ
TITSIFGTTFEFFNMLETTVMKFIDDDHVDEINDLHVNKWAEMRILSQPPVANEHLTAYMDKYALDKHSIPLSNG
KMKSILGYQLRKPLFTKETIIGMVEQWKEERTFPCLD*
Coding >AgabiH97|059320
ATGGCCAACAAACCCAGCGCCATTATATTTGGTGGCCTCAACACCTGCTCGCGCGCCCTGGCTTCCTATCTCGTC
CCACTGGAAGGCGAACCCCTTGTCTCCCATCTGCGGATCATCGACAAGTATTCCGTCGTGCCCGCCACTACTTAC
ATCGGTTCCGAATTCCCCAAACTTCTGGAGAAACCACAGGTGGAATACCGTCAAGTCAATCTGACTGTTCCCGAA
AAAATTCCCCCCGTTTTTGAGCCGCCCGCCGGTATACCCCCATTCGAATATGTTTTTGACTTCACCGGCGAGATC
TGGGCCGATCGTTCTGAGGAGATCATCATAAATTTCACATGCCACACCGCCAAGCTGATTGGCGAAGAGGCCGCA
AGACGCAAAGTCAAAGCCTATGTGCGGATCCATCAGCCTTATTATAAGGTCTCAGGCAAAGTCCCGCAAGATGAA
AATAGCCAAGTCCAGCCATGGGGCACAATTGGCACTTGGTGGCACGAGACCCTAAGGATCCTTGGTGCAATTGAG
GGGTTAAACTTGGTCATCCTGAGACCCGGCTTTGTATACGGACCTTATACAAACTATGGCATTATTGCTTCCGCG
ATCGTCATAGCGTCTGTTTATGGCCATCTTCATAAACCAATGAAGTCAATGTGGTCTCCCGGCAAGAACATCACA
TATACGGTCCATGTCGAGGATGTAGCTGGTGCAGCCTGGGCCGCTGCCCATTGGATTGCGCAACTGGGGAGGCAG
GCTGCCGACGAGAAGGCTGGAGTCGAGATCGTTTCATATGCCCCTCAGACTACCCAGTCGCCAGAATTGATACCC
AAGAACCAGAAAGTTATTGCTCCTGTTTTCAACGTGACTGATGATTCCAATAGCACACATCTGAGTGTTGGCCAG
ACCATTACATCTATTTTCGGTACGACCTTCGAGTTCTTCAACATGTTGGAGACCACTGTGATGAAGTTTATCGAC
GATGACCATGTGGATGAAATTAATGACCTCCATGTCAACAAGTGGGCTGAAATGAGAATCCTCTCCCAGCCTCCT
GTTGCAAACGAGCATCTCACGGCTTATATGGACAAATACGCTCTTGATAAGCATTCTATCCCCCTCAGTAACGGC
AAAATGAAAAGCATCCTGGGATACCAACTGCGCAAACCCTTGTTCACCAAAGAAACCATCATCGGAATGGTTGAA
CAATGGAAAGAGGAGAGAACATTTCCCTGTCTGGATTGA
Transcript >AgabiH97|059320
ATGGCCAACAAACCCAGCGCCATTATATTTGGTGGCCTCAACACCTGCTCGCGCGCCCTGGCTTCCTATCTCGTC
CCACTGGAAGGCGAACCCCTTGTCTCCCATCTGCGGATCATCGACAAGTATTCCGTCGTGCCCGCCACTACTTAC
ATCGGTTCCGAATTCCCCAAACTTCTGGAGAAACCACAGGTGGAATACCGTCAAGTCAATCTGACTGTTCCCGAA
AAAATTCCCCCCGTTTTTGAGCCGCCCGCCGGTATACCCCCATTCGAATATGTTTTTGACTTCACCGGCGAGATC
TGGGCCGATCGTTCTGAGGAGATCATCATAAATTTCACATGCCACACCGCCAAGCTGATTGGCGAAGAGGCCGCA
AGACGCAAAGTCAAAGCCTATGTGCGGATCCATCAGCCTTATTATAAGGTCTCAGGCAAAGTCCCGCAAGATGAA
AATAGCCAAGTCCAGCCATGGGGCACAATTGGCACTTGGTGGCACGAGACCCTAAGGATCCTTGGTGCAATTGAG
GGGTTAAACTTGGTCATCCTGAGACCCGGCTTTGTATACGGACCTTATACAAACTATGGCATTATTGCTTCCGCG
ATCGTCATAGCGTCTGTTTATGGCCATCTTCATAAACCAATGAAGTCAATGTGGTCTCCCGGCAAGAACATCACA
TATACGGTCCATGTCGAGGATGTAGCTGGTGCAGCCTGGGCCGCTGCCCATTGGATTGCGCAACTGGGGAGGCAG
GCTGCCGACGAGAAGGCTGGAGTCGAGATCGTTTCATATGCCCCTCAGACTACCCAGTCGCCAGAATTGATACCC
AAGAACCAGAAAGTTATTGCTCCTGTTTTCAACGTGACTGATGATTCCAATAGCACACATCTGAGTGTTGGCCAG
ACCATTACATCTATTTTCGGTACGACCTTCGAGTTCTTCAACATGTTGGAGACCACTGTGATGAAGTTTATCGAC
GATGACCATGTGGATGAAATTAATGACCTCCATGTCAACAAGTGGGCTGAAATGAGAATCCTCTCCCAGCCTCCT
GTTGCAAACGAGCATCTCACGGCTTATATGGACAAATACGCTCTTGATAAGCATTCTATCCCCCTCAGTAACGGC
AAAATGAAAAGCATCCTGGGATACCAACTGCGCAAACCCTTGTTCACCAAAGAAACCATCATCGGAATGGTTGAA
CAATGGAAAGAGGAGAGAACATTTCCCTGTCTGGATTGA
Gene >AgabiH97|059320
ATGGCCAACAAACCCAGCGCCATTATATTTGGTCGGTTTTCACTCGCACTCTCTCTGCGCCCAACACTGACAATC
GTACAGGTGGCCTCAACACCTGCTCGCGCGCCCTGGCTTCCTATCTCGTCCCACTGGAAGGCGAACCCCTTGTCT
CCGTACGCCACTCCTTCGCCGCCGTTCTGCCTGCTGGCTCAGAATTATGACTTTAGCATCTGCGGATCATCGACA
AGTATTCCGTCGTGCCCGCCACTACGTGAGTTCATCCCCCCCATCTCGTAGCTTTTCACGTCATCTTACTAACAG
ATCTTCGATACCTTTCATTCTTCATAATGCAACAGTTACATCGGTTCCGAATTCCCCAAACTTCTGGAGAAACCA
CAGGTGGAATACCGTCAAGTCAATCTGACTGTTCCCGGTATGCCTTGATCTCCATCCCGTCCGTCGCCCAATCCA
ACTCTGCAGCGCAGAAAAAATTCCCCCCGTTTTTGAGCCGCCCGCCGGTATACCCCCATTCGAATATGTTTTTGA
CTTCACCGGCGAGATCTGGGCCGATCGTTCTGAGGAGGTATGTTATCTGATCTCCCGATCTTACCCCTCTAAACT
TTGCACCTACACCCTGAATCTCGGAATTACCTTTTCATTCCCCTTAAGCGATGCATATTTTGACACTGTCGTTGT
TCGTTTTTGCTCGTTAGATCATCATAAATTTCACATGCCACACCGCCAAGCTGATTGGCGAAGAGGCCGCAAGAC
GCAAAGTCAAAGCCTATGTGCGGATCCATCAGCCTTATTATAAGGTCTCAGGCAAAGTCCCGCAAGATGAAAATA
GCCAAGTCCAGCCATGGGGCACAATTGGCACTTGGTGGCACGAGACCCTAAGGATCCTTGGTGCAATTGAGGGGT
TAGACTACTTCCGTTCGTAGCGTGCGGCCAGTGATTTATGCCTCATAGGTTAAACTTGGTCATCCTGAGACCCGG
CTTTGTATACGGACCTTATACAAACTATGGCATTAGTACGTCTCGTATCGAGCCTCCGCCAGGAGAGCACACACT
GATACCGTCTTATACAGTTGCTTCCGCGATCGTCATAGCGTCTGTTTATGGCCATCTTCATAAACCAATGAAGTC
AATGTACGCCCCTCTGTAAGCCTATCTGACCATCGACACTAATCACAATGCCTTAGGTGGTCTCCCGGCAAGAAC
ATCACATATACGGTCCATGTCGAGGATGTAGCTGGTGCAGCCTGGGCCGCTGCCCATTGGATTGCGCAACTGGGG
AGGCAGGCTGCCGACGAGAAGGCTGGAGTCGAGATCGTTTCATATGCCCCTCAGACTACCCAGTCGCCAGAATTG
ATACCCAAGAACCAGAAAGTTATTGCTCCTGTTTTCAACGTGGCAAGTAGTGGGTTATCTATAAAATATGGGATA
GACGACTGATTACGCCACTAGACTGATGATTCCAATAGCACACATCTGAGTGTTGGCCAGACCATTACATCTATT
TTCGGTACGACCTTCGAGTTCTTCAACATGTTGGAGACCACTGTGATGAAGGTATATAAAATGTCCGCCCTTTTT
TCATTCTACTAATTCTTTCTTTCCATCAGTTTATCGACGATGACCATGTGGATGAAATTAATGACCTCCATGTCA
ACAAGTGGGCTGAAATGAGAATCCTCTCCCAGCCTCCTGTTGCAAACGAGCATCTCACGGCTTATATGGACAAAT
ACGCTCTTGATAAGCATTCTATCCCCCTCAGTAACGGCAAAATGAAAAGCATCCTGGGATACCAACTGCGCAAAC
CCTTGTTCACCAAAGAAACCATCATCGGAATGGTTGAACAATGGAAAGAGGAGAGAACATTTCCCTGTCTGGATT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail