Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059280
Gene name
Locationscaffold_3:1594328..1599123
Strand+
Gene length (bp)4795
Transcript length (bp)3066
Coding sequence length (bp)3066
Protein length (aa) 1022

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 6.3E-22 265 437
PF00271 Helicase_C Helicase conserved C-terminal domain 2.1E-14 499 606
PF09369 MZB MrfA Zn-binding domain 7.9E-15 869 950
PF04851 ResIII Type III restriction enzyme, res subunit 6.8E-07 263 435
PF08839 CDT1 DNA replication factor CDT1 like 2.7E-06 10 71

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05549|HRQ1_YEAST ATP-dependent helicase HRQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRQ1 PE=1 SV=1 3 1001 0.0E+00
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 12 983 0.0E+00
sp|P50830|YPRA_BACSU Uncharacterized ATP-dependent helicase YprA OS=Bacillus subtilis (strain 168) GN=yprA PE=3 SV=1 224 950 8.0E-114
sp|Q58969|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1 262 763 3.0E-48
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 257 611 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05549|HRQ1_YEAST ATP-dependent helicase HRQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRQ1 PE=1 SV=1 3 1001 0.0E+00
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 12 983 0.0E+00
sp|P50830|YPRA_BACSU Uncharacterized ATP-dependent helicase YprA OS=Bacillus subtilis (strain 168) GN=yprA PE=3 SV=1 224 950 8.0E-114
sp|Q58969|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1 262 763 3.0E-48
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 257 611 3.0E-19
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 262 609 1.0E-17
sp|O27830|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1 240 608 3.0E-17
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 248 606 1.0E-14
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 244 671 1.0E-14
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 258 636 2.0E-13
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 258 636 2.0E-11
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 257 636 9.0E-11
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 253 640 6.0E-10
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 267 614 2.0E-09
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 263 635 3.0E-09
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 263 606 5.0E-09
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 267 614 8.0E-09
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 263 438 9.0E-09
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 241 606 1.0E-08
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 260 635 2.0E-08
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 262 606 2.0E-08
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 267 670 2.0E-08
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 263 632 3.0E-08
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 267 670 4.0E-08
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 262 611 4.0E-08
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 262 619 6.0E-08
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 267 670 9.0E-08
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 267 670 1.0E-07
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 260 635 1.0E-07
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 260 606 2.0E-07
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 267 670 2.0E-07
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 508 606 3.0E-07
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 267 670 4.0E-07
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 260 635 8.0E-07
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 262 606 1.0E-06
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 263 438 2.0E-06
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 258 438 5.0E-06
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 267 645 6.0E-06
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 541 637 7.0E-06
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 494 657 7.0E-06
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 494 659 8.0E-06
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 248 438 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059280
MSSGQSISLHCLLCVFKALNTVLAFISSKKQIATTFDAIRSSVEGILKRPLELQAVAEIKALLPDIVKFSYIPRN
DSAINENADLKGKHRAKSPDFVIPSTRVANVSGEGRILVLEFADNLRGKKSRNAGLSYQQTPSLTPAAMKLLIET
RNDIFGQAVNDLILATMHQSDPVQMLQQAAREHVPVVPYALITPSDQECATNTNARPSVNDLVQKMMDQDWYREQ
IIFRKTVDAREPLHGELGSSLSPSITSALATSRSIGSFYAHQSEAIRALFEGKHVVVSTSTASGKSLIYQVPILK
FLEDDIEAKAICIYPTKALEQDQKASLEKMIQNCPGLEHIRVSTYDGDTPQELRPTIREESSVIFTNFDTIHASI
LPHEDNWRSFLRQVKLVVVDELHYYSGLLGSHVAFIMRRFRRICAAVGNRQIRFISCTATLGNPGAHMQKIFCLG
EDEIQVVDTDGAPSGRKDFLVWNPPLIDNANKNLGRRGSISEATLLMRFLMQQGARVLLFCKIRKVCELAMRAIR
ADLSNEGQLNILAKVKAYRGGYSQEDRRRIEEEAFSGQLLGIIATNALELGIDIGALDIVIMLGFPMSVASFRQQ
AGRAGRRVRDSLAIFVADPFPIDQYYVNHSEELFSHAMEDLVIDTESPVILEAHLQCAAHEMPIHREDKQYFGAL
MLDICEKKLLKDRDGWYQTHPNFLPYPPRFVSIRGAQEERYAVICVKTDAANIILEEVEVSRAMFEIYEGGIFMH
QGEAYIVTEVSHDNKIAKVIQANVNYHTSPRDFTNVDAVRTTRIRAIGNHRAFYGMVNVEVKVFGFFKIRNNTIL
DAVEIDTPPYVCDTTGFWIDVPRSILELLRRKHFNLAEAIHAAQHAFLNQFPLSEDLRTECKAAEKEYRVTESSR
KRPARIIFYDSIGKGGGVAAKAFDYAHETLRKAHSALENCHCEDGCGNCVQSATCREANQVSSKLGGGIIIRSIL
GLPIDPDVVTLQSGQQIQIPDTIAEAQTVYGRGNIEVEEEGSDRLH*
Coding >AgabiH97|059280
ATGTCGAGTGGCCAGAGCATTTCACTTCATTGTTTGCTGTGTGTTTTTAAGGCCTTAAACACCGTTCTAGCCTTT
ATATCTTCCAAGAAACAAATAGCGACAACATTTGACGCTATAAGATCGTCCGTGGAAGGCATTTTGAAACGACCT
TTGGAGCTGCAAGCTGTCGCAGAGATCAAAGCTCTTCTTCCTGACATCGTCAAATTTTCATACATACCTCGAAAT
GATTCCGCAATCAACGAGAACGCTGATCTTAAGGGGAAGCACAGAGCGAAATCTCCTGACTTTGTCATTCCTTCT
ACAAGAGTGGCAAATGTGAGCGGGGAAGGGCGCATTCTCGTTCTCGAATTCGCTGATAACCTAAGAGGGAAGAAG
TCACGGAATGCTGGGTTAAGCTACCAGCAGACTCCTTCCTTGACACCCGCGGCGATGAAGCTGCTCATTGAAACA
CGAAATGATATCTTTGGGCAGGCAGTAAATGATCTCATACTTGCAACAATGCACCAAAGTGATCCCGTCCAGATG
CTCCAACAGGCCGCTCGGGAGCATGTACCAGTTGTGCCCTATGCGCTAATAACTCCTTCAGATCAAGAATGCGCC
ACGAACACTAATGCACGACCTTCCGTGAACGACTTGGTACAAAAGATGATGGATCAGGATTGGTATCGGGAACAG
ATTATATTTCGTAAGACAGTAGATGCTCGAGAACCACTGCACGGCGAACTGGGGTCTTCGCTTTCCCCTAGTATA
ACTTCCGCTCTGGCCACCTCGAGGAGCATCGGATCATTTTATGCCCACCAATCAGAAGCGATACGTGCTCTCTTC
GAAGGAAAACATGTAGTCGTGTCGACGAGCACAGCTTCAGGAAAGAGTTTGATATATCAAGTTCCGATTCTCAAG
TTCCTCGAAGATGACATTGAGGCAAAGGCAATTTGCATATACCCTACAAAGGCATTGGAACAAGACCAGAAGGCA
TCTCTTGAAAAAATGATTCAGAATTGTCCTGGCCTAGAACATATCCGAGTCTCTACGTATGATGGCGATACTCCA
CAAGAACTGCGACCGACTATACGAGAAGAGTCCTCAGTCATTTTCACGAACTTCGATACAATCCATGCATCCATC
TTACCTCATGAGGATAATTGGAGGAGTTTTCTGCGTCAAGTCAAGCTTGTTGTAGTGGATGAGCTACACTACTAT
TCCGGCCTTCTTGGAAGCCACGTTGCTTTCATTATGCGAAGGTTCAGGCGCATATGTGCAGCTGTCGGAAATCGC
CAAATTCGTTTCATTTCCTGTACCGCTACTCTTGGTAATCCAGGTGCCCACATGCAGAAGATTTTTTGCCTCGGA
GAAGACGAAATCCAGGTGGTAGATACTGACGGCGCGCCTTCTGGAAGGAAGGATTTCCTCGTATGGAATCCGCCG
TTGATTGACAATGCAAACAAGAATCTCGGAAGGCGAGGGTCAATCTCTGAGGCTACATTGCTGATGCGCTTTTTG
ATGCAGCAAGGTGCTCGCGTCCTTTTATTCTGCAAAATACGGAAAGTTTGTGAGCTGGCCATGAGGGCCATACGA
GCGGATCTAAGCAATGAAGGACAGCTTAATATTTTAGCCAAAGTAAAAGCATATCGAGGAGGTTATTCACAAGAA
GATCGTCGTCGCATCGAAGAAGAGGCGTTCTCTGGACAATTGCTTGGAATCATCGCGACAAATGCTCTTGAGCTG
GGTATTGACATTGGTGCTCTTGATATTGTCATCATGCTTGGCTTTCCCATGAGCGTCGCCAGCTTTCGTCAACAA
GCTGGAAGAGCTGGACGTCGCGTGCGGGACTCATTAGCCATTTTCGTTGCAGACCCATTCCCAATAGATCAGTAC
TATGTCAATCACTCGGAAGAGCTTTTCAGCCACGCAATGGAAGATCTAGTGATTGACACAGAAAGCCCGGTGATT
TTAGAAGCGCATTTACAATGCGCTGCACATGAGATGCCTATCCACAGAGAGGATAAACAATACTTCGGTGCTCTG
ATGCTTGATATCTGCGAGAAGAAGTTGCTCAAGGATAGAGATGGCTGGTATCAAACCCACCCTAATTTTTTGCCC
TACCCACCTCGCTTTGTATCCATCCGTGGCGCTCAGGAAGAAAGATATGCTGTCATCTGCGTCAAAACTGATGCA
GCAAACATCATTCTTGAAGAGGTCGAAGTATCGCGTGCGATGTTCGAAATTTATGAAGGCGGCATTTTTATGCAT
CAAGGCGAAGCATATATCGTTACGGAGGTTAGTCATGATAACAAGATAGCCAAAGTCATTCAAGCGAATGTCAAT
TATCACACGTCACCTCGGGATTTCACAAATGTAGATGCCGTTCGCACGACTCGAATCAGAGCCATTGGTAACCAT
CGTGCTTTCTACGGAATGGTCAACGTGGAAGTGAAAGTGTTCGGATTCTTCAAAATTAGGAACAACACAATTCTC
GATGCTGTCGAGATTGATACGCCTCCTTACGTATGCGATACGACAGGTTTTTGGATAGATGTTCCGCGTTCGATT
CTAGAATTACTGCGTCGCAAGCATTTCAATTTGGCTGAGGCTATACATGCAGCTCAACATGCCTTCCTCAACCAA
TTTCCATTGTCCGAGGATCTCAGGACGGAGTGCAAGGCAGCGGAGAAAGAGTATAGGGTCACAGAGTCATCTAGA
AAGAGACCGGCAAGAATCATTTTTTATGATTCTATTGGCAAAGGTGGTGGGGTGGCTGCAAAAGCTTTCGACTAT
GCTCATGAGACCTTGCGAAAAGCCCATTCTGCTTTAGAGAATTGCCATTGCGAGGATGGTTGCGGAAACTGCGTA
CAAAGCGCCACTTGCAGGGAAGCCAACCAAGTTTCTTCAAAATTAGGAGGTGGTATAATCATAAGGAGTATCCTT
GGCCTACCGATCGATCCGGACGTGGTAACACTTCAAAGTGGGCAACAAATTCAGATACCAGATACGATAGCAGAA
GCGCAAACTGTATATGGGCGAGGAAACATCGAGGTAGAGGAGGAAGGAAGTGACCGGCTACACTAA
Transcript >AgabiH97|059280
ATGTCGAGTGGCCAGAGCATTTCACTTCATTGTTTGCTGTGTGTTTTTAAGGCCTTAAACACCGTTCTAGCCTTT
ATATCTTCCAAGAAACAAATAGCGACAACATTTGACGCTATAAGATCGTCCGTGGAAGGCATTTTGAAACGACCT
TTGGAGCTGCAAGCTGTCGCAGAGATCAAAGCTCTTCTTCCTGACATCGTCAAATTTTCATACATACCTCGAAAT
GATTCCGCAATCAACGAGAACGCTGATCTTAAGGGGAAGCACAGAGCGAAATCTCCTGACTTTGTCATTCCTTCT
ACAAGAGTGGCAAATGTGAGCGGGGAAGGGCGCATTCTCGTTCTCGAATTCGCTGATAACCTAAGAGGGAAGAAG
TCACGGAATGCTGGGTTAAGCTACCAGCAGACTCCTTCCTTGACACCCGCGGCGATGAAGCTGCTCATTGAAACA
CGAAATGATATCTTTGGGCAGGCAGTAAATGATCTCATACTTGCAACAATGCACCAAAGTGATCCCGTCCAGATG
CTCCAACAGGCCGCTCGGGAGCATGTACCAGTTGTGCCCTATGCGCTAATAACTCCTTCAGATCAAGAATGCGCC
ACGAACACTAATGCACGACCTTCCGTGAACGACTTGGTACAAAAGATGATGGATCAGGATTGGTATCGGGAACAG
ATTATATTTCGTAAGACAGTAGATGCTCGAGAACCACTGCACGGCGAACTGGGGTCTTCGCTTTCCCCTAGTATA
ACTTCCGCTCTGGCCACCTCGAGGAGCATCGGATCATTTTATGCCCACCAATCAGAAGCGATACGTGCTCTCTTC
GAAGGAAAACATGTAGTCGTGTCGACGAGCACAGCTTCAGGAAAGAGTTTGATATATCAAGTTCCGATTCTCAAG
TTCCTCGAAGATGACATTGAGGCAAAGGCAATTTGCATATACCCTACAAAGGCATTGGAACAAGACCAGAAGGCA
TCTCTTGAAAAAATGATTCAGAATTGTCCTGGCCTAGAACATATCCGAGTCTCTACGTATGATGGCGATACTCCA
CAAGAACTGCGACCGACTATACGAGAAGAGTCCTCAGTCATTTTCACGAACTTCGATACAATCCATGCATCCATC
TTACCTCATGAGGATAATTGGAGGAGTTTTCTGCGTCAAGTCAAGCTTGTTGTAGTGGATGAGCTACACTACTAT
TCCGGCCTTCTTGGAAGCCACGTTGCTTTCATTATGCGAAGGTTCAGGCGCATATGTGCAGCTGTCGGAAATCGC
CAAATTCGTTTCATTTCCTGTACCGCTACTCTTGGTAATCCAGGTGCCCACATGCAGAAGATTTTTTGCCTCGGA
GAAGACGAAATCCAGGTGGTAGATACTGACGGCGCGCCTTCTGGAAGGAAGGATTTCCTCGTATGGAATCCGCCG
TTGATTGACAATGCAAACAAGAATCTCGGAAGGCGAGGGTCAATCTCTGAGGCTACATTGCTGATGCGCTTTTTG
ATGCAGCAAGGTGCTCGCGTCCTTTTATTCTGCAAAATACGGAAAGTTTGTGAGCTGGCCATGAGGGCCATACGA
GCGGATCTAAGCAATGAAGGACAGCTTAATATTTTAGCCAAAGTAAAAGCATATCGAGGAGGTTATTCACAAGAA
GATCGTCGTCGCATCGAAGAAGAGGCGTTCTCTGGACAATTGCTTGGAATCATCGCGACAAATGCTCTTGAGCTG
GGTATTGACATTGGTGCTCTTGATATTGTCATCATGCTTGGCTTTCCCATGAGCGTCGCCAGCTTTCGTCAACAA
GCTGGAAGAGCTGGACGTCGCGTGCGGGACTCATTAGCCATTTTCGTTGCAGACCCATTCCCAATAGATCAGTAC
TATGTCAATCACTCGGAAGAGCTTTTCAGCCACGCAATGGAAGATCTAGTGATTGACACAGAAAGCCCGGTGATT
TTAGAAGCGCATTTACAATGCGCTGCACATGAGATGCCTATCCACAGAGAGGATAAACAATACTTCGGTGCTCTG
ATGCTTGATATCTGCGAGAAGAAGTTGCTCAAGGATAGAGATGGCTGGTATCAAACCCACCCTAATTTTTTGCCC
TACCCACCTCGCTTTGTATCCATCCGTGGCGCTCAGGAAGAAAGATATGCTGTCATCTGCGTCAAAACTGATGCA
GCAAACATCATTCTTGAAGAGGTCGAAGTATCGCGTGCGATGTTCGAAATTTATGAAGGCGGCATTTTTATGCAT
CAAGGCGAAGCATATATCGTTACGGAGGTTAGTCATGATAACAAGATAGCCAAAGTCATTCAAGCGAATGTCAAT
TATCACACGTCACCTCGGGATTTCACAAATGTAGATGCCGTTCGCACGACTCGAATCAGAGCCATTGGTAACCAT
CGTGCTTTCTACGGAATGGTCAACGTGGAAGTGAAAGTGTTCGGATTCTTCAAAATTAGGAACAACACAATTCTC
GATGCTGTCGAGATTGATACGCCTCCTTACGTATGCGATACGACAGGTTTTTGGATAGATGTTCCGCGTTCGATT
CTAGAATTACTGCGTCGCAAGCATTTCAATTTGGCTGAGGCTATACATGCAGCTCAACATGCCTTCCTCAACCAA
TTTCCATTGTCCGAGGATCTCAGGACGGAGTGCAAGGCAGCGGAGAAAGAGTATAGGGTCACAGAGTCATCTAGA
AAGAGACCGGCAAGAATCATTTTTTATGATTCTATTGGCAAAGGTGGTGGGGTGGCTGCAAAAGCTTTCGACTAT
GCTCATGAGACCTTGCGAAAAGCCCATTCTGCTTTAGAGAATTGCCATTGCGAGGATGGTTGCGGAAACTGCGTA
CAAAGCGCCACTTGCAGGGAAGCCAACCAAGTTTCTTCAAAATTAGGAGGTGGTATAATCATAAGGAGTATCCTT
GGCCTACCGATCGATCCGGACGTGGTAACACTTCAAAGTGGGCAACAAATTCAGATACCAGATACGATAGCAGAA
GCGCAAACTGTATATGGGCGAGGAAACATCGAGGTAGAGGAGGAAGGAAGTGACCGGCTACACTAA
Gene >AgabiH97|059280
ATGTCGAGTGGCCAGAGCATTTCACTTCAGTACGCCCTCTCAGGCGCTGGCCTGGTTCACAGTACTGACTTCCCT
CCTAGTTGTTTGCTGTGTGTTTCTATCTAATACTCTAACACTCCGACCTCGTTTACTGACCTCTTCTTACCCAGG
TTTTTAAGGTATCTTACTGGGCGCATTATAATCTACGATTCTCTGACTGTTTCAAGGCCTTAAACACCGTTCTAG
CCTTTATATCTTCCAAGAAACAAATAGCGACAACATTTGACGCTATAAGATCGTCCGTGGAAGGCATTTTGAAAC
GGCAAGTGAAAGACTTTCGCGAGAGTTTAGCTTGACGGATGGATTATGCGCAGACCTTTGGAGCTGCAAGCTGTC
GCAGAGATCAAGTCCGTTTAAATAGCTTTGGCCCACGGAAGTATGACTCACTTTCGCCTAGAGCTCTTCTTCCTG
ACATCGTCAAATTTTCATACATACCTCGAAATGATTCCGCAATCAACGAGAACGCTGATCTTAAGGGGAAGCACA
GAGCGAAATCTCCTGACTTTGTCATTCCTTCTACAAGAGTGGCAAATGTGAGCGGGGAAGGGCGCATTCTCGTTC
TCGAATTCGCTGATAACCTAAGAGGGAAGAAGTCACGGAATGCTGGGTAAGACTATAGTGATAAGTAATATGAGT
ATTATGGTTTTGTACTAACACCTGTGGTAGGTTAAGCTACCAGCAGACTCCTTCCTTGACACCCGCGGCGATGAA
GCTGCTCATTGAAACACGAAATGATATCTTTGGGCAGGCAGTAAATGAGTAAATCTCTCTACATCTCAATGACTC
CTTTATCTGATCTACCATGCTTTTAGTCTCATACTTGCAACAATGCACCAAAGTGATCCCGTCCAGATGCTCCAA
CAGGCCGCTCGGGAGCATGTACCAGTTGTGCCCTATGCGCTAATAACTCCTTCAGATCAAGAATGCGCCACGAAC
ACTAATGCACGACCTTCCGTGAACGACTTGGTACAAAAGATGATGGATCAGGATTGGTATCGGGAACAGATTATA
TTTCGTAAGACAGTAGATGCTCGAGAACCACTGCACGGTGAACTTTTCCACTGGCTTATAAATGCATTGAGACAC
TGACCAAATCAAAAGGCGAACTGGGGTCTTCGCTTTCCCCTAGTATAACTTCCGCTCTGGCCACCTCGAGGAGCA
TCGGATCATTTTATGCCCACCAATCAGAAGCGATACGTGCTCTCTTCGAAGGAAAACATGTAGTCGTGTCGACGA
GCACAGCTTCAGGAAAGAGTTTGATATATCAAGTGAGTACTCCATACCTTTTTGAATCGGCGTTCAGAAAATGAT
ACTTGCAGGTTCCGATTCTCAAGTTCCTCGAAGATGACATTGAGGCAAAGGCAATTTGCATATACCCTACAAAGG
TAAAAATGACGAAACGTTGTTGTCTATATTCCGTTCACATTTTTCAGGCATTGGAACAAGACCAGAAGGCATCTC
TTGAAAAAATGATTCAGAATTGTCCTGGCCTAGAACATATCCGAGTCTCTACGTATGATGGCGATACTCCACAAG
AACTGCGACCGAGTTAGTACCACCACAAACTTTCTTCTACATGAGAAGCTCAATTTGGTCCAGCTATACGAGAAG
AGTCCTCAGTCATTTTCACGAACTTCGTAAGTTTATCCAAGTCGACTTGTGTTTGCAGCTCTCAATTCCCAAGGA
TACAATCCATGCATCCATCTTACCTCATGAGGATAATTGGAGGAGGTGAGGTCTTGTCGTTGATGTATCAATGGA
AATTTTGAAATTTCTGTAGTTTTCTGCGTCAAGTCAAGGTAAGCTGCGACCGATTGTTCCAGGCTAACAGTTTGT
TATATTTTCTTGTCAGCTTGTTGTAGTGGATGAGCTACACTACTATTCCGGCCTTCTTGGAAGGTGAGATTTACA
GCAACTAATCTCTCACGTTCCGGACTGAAAGTGGATGCAGCCACGTTGCTTTCATTATGCGAAGGTTCAGGCGCA
TATGTGCAGCTGTCGGAAGTTTGTAGTGCACTCTCGCAGCTCCTTCCATCAAAACTAAACTTTCCGTCCAATAGA
TCGCCAAATTCGTTTCATTTCCTGTACCGCTACTCTTGGTAATCCAGGTGCCCACATGCAGAAGATTTTTTGCCT
CGGAGAAGACGAAATCCAGGTGGTAGATACTGACGGCGCGCCTTCTGGAAGGAAGGATTTCCTCGTATGGAATCC
GCCGTTGATTGACAATGCAAACAAGAATCTCGGAAGGCGAGGGTCAATCTCTGAGGCTACATTGCTGATGCGCTT
TTTGATGCAGCAAGGTGCTCGCGTCCTTTTATTCTGCAAAGTATGTGCCACTGAATCCTTCCCCTATTCGGCGTT
AATGAGAGCTTGCAGATACGGAAAGTTTGTGAGCTGGTAGGTAGACTGTCTTGTCAGTGCGGTGAAAAATCAATG
TATCAACCACTGTTTAGGCCATGAGGGCCATACGAGCGGATCTAAGCAATGAAGGACAGCTTAATATTTTAGCCA
AAGTAAAAGCATATCGAGGAGGTGACAACTGATGAGTGTTTGACCTCGATGCACTGACAAATCGTATCTTTCATA
GGTTATTCACAAGAAGTATATATCCACCTTGGACTGCATGCAGACAATGTAATTCTTTGCACAGGATCGTCGTCG
CATCGAAGAAGAGGCGTTCTCTGGACAATTGCTTGGAATCATCGCGACAAATGCTCTTGAGCTGGGTATTGACAT
TGGTGCTCTTGATATTGTCATCATGCTTGGCTTTCCCATGAGCGTCGCCAGCTTTGTGAGTACCCTTATCCCGCT
AAAATGTAGAAGAAACTTAGTATGGTTCGATTCTCGCCCAGCGTCAACAAGCTGGAAGAGCTGGACGTCGCGTGC
GGGACTCATTAGCCATTTTCGTTGCAGACCCATTCCCAATAGATCAGTACTATGTCAATCACTCGGAAGAGCTTT
TCAGCCACGCAATGGAAGATCTAGTGATTGACACAGAAAGCCCGGTGATTTTAGAAGGTGTGTCTAATGACTTTT
ATCTAACAAAAATTAACTTTACTAGCGCATTTACAATGCGCTGCACATGAGATGCCTATCCACAGAGAGGATAAA
CAATACTTCGGTGCTCTGATGCTTGATATCTGCGAGAAGAAGTTGCTCAAGGATAGAGATGGCTGGTGAGTTTTT
GAATGTGCTCGCTTTGGAAAGTTTTGAATATATGTACATAGGTATCAAACCCACCCTAATTTTTTGCCCTACCCA
CCTCGCTTTGTATCCATCCGTAAGTGGGCCACCTCGAGAGGCAAATACAAGAGACCAACATTTTCTCAGGTGGCG
CTCAGGAAGAAAGATATGCTGTCATCTGCGTCAAAACTGATGCAGCAAACATCATTCTTGAAGAGGTCGAAGTAT
CGCGTGCGATGTTCGAAATTTATGAAGGCGGCATTGTATGTTTCACCAATTATTATAACTTTTTCATTCTGATAT
CCGATACAATTGCTTTTTAGTTTATGCATCAAGGCGAAGCATATATCGTCAGCTCCAGCGTTATAGGCCATTCAT
ATAGTTCACTAAAATACTTGCTTTCGCGTGATAGGTTACGGAGGTTAGTCATGATAACAAGATAGCCAAAGTCAT
TCAAGCGAATGTCAATTATCACACGTCACCTCGGTATGTTTGACATATCTAAGTTGACCGTTTGACTGAAAATAA
ATCCGCGATAGGGATTTCACGTTCGTCCCCCGCTCCTGCTAGAATGACTGATTTTTCAAGTTGGATTTAGAAATG
TAGATGCCGTTCGCACGACTCGAATCAGAGCCATTGGTAACCATCGTGCTTTCTACGGAAGTGAGTCGCAAACTT
ATTTCAGAGCGACCGTCAAGATCACCTTAATTTCTTTTAGTGGTCAACGTGGAAGTGAAAGTGTTCGGTATGTCT
GATTTTCATGCTTAAGGGACATATAATAATGGACATCGAAAGGATTCTTCAAAATTAGGAACAACACAATTCTCG
ATGCTGTCGAGATTGATACGCCTCCTTACGTATGCGATACGACAGGTTTTTGGATAGATGTTCCGCGTTCGATTC
TAGAATTACTGCGTCGCAAGCATTTCAATTTGGCTGAGGCTATACATGCAGCTCAACATGCCTTCCTCAACCAAT
TTCCATTGTCCGAGGATCTCAGGACGGAGTGCAAGGCAGCGGAGAAAGAGTATAGGGTCACAGAGTCATCTAGAA
AGAGACCGGCAAGGCGGGTTTTCTGTTTCCCTATTTGACTTCTAATTTTACTTAATCTTTTCAGAATCATTTTTT
ATGATTCTATTGGCAAAGGTGGTGGGGTGGCTGCAAAAGCTTTCGACTATGGTCAGTACATCCTTGAGTCTTCAC
AGTGCACTTTCTCATGTTTGATGATAGCTCATGAGACCTTGCGAAAAGCCCATTCTGCTTTAGAGAATTGCCATT
GCGAGGATGGTTGCGGAAACTGTGAGGATTTGATTACCTCGCCCTTCCACTCATCTCGTACTCACCCGAGACAGG
CGTACAAAGCGCCACTTGCAGGGAAGCCAACCAAGTTTCTTCAAAATTAGGAGGTGGTATAATCATAAGGAGTAT
CCTTGGCCTACCGATCGATCCGGACGTGGTAACACTTCAAAGTGGGCAACAAATTCAGATACCAGATACGATAGC
AGAAGCGCAAACTGTATATGGGCGAGGAAACATCGAGGTAGAGGAGGAAGGAAGTGACCGGCTACACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail