Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059200
Gene name
Locationscaffold_3:1576747..1577762
Strand+
Gene length (bp)1015
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11968 Bmt2 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2 2.4E-60 60 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH2|BMT2_SCHPO 25S rRNA adenine-N(1) methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.10 PE=3 SV=1 7 275 1.0E-32
sp|P38278|BMT2_YEAST 25S rRNA (adenine(2142)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT2 PE=1 SV=2 29 277 3.0E-26

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059200
MPKTKKRKLPISNPLDNYVATSRPQSSRSVIRRFHVLIKKEAQLKCNRSPGAAETEDLVKIQHEIQELGGLQRYQ
RMSTVGQSGDRGGGSEKVFIEWMKELKLHVSEMQIKLRLLEVGALKPDNFTSCTSWIENTPIDLRPQHPAIQEQD
FLLLDPVENERKWDAISLSLVLNFVPLAVDRGSMLQLANTILKDKGYLFLALPLPCLINSRYMSFEHFTRLMETL
GFSELRCRWKKGGKMAYWLYQKQQKPRQEEFGGFVKKVVLRHGNRNNFAVLLKNS*
Coding >AgabiH97|059200
ATGCCCAAGACCAAGAAACGTAAATTACCCATCTCCAATCCACTTGACAACTACGTTGCGACAAGCAGGCCGCAA
TCCAGCCGCAGTGTTATTCGTCGGTTTCACGTGCTTATCAAAAAAGAAGCTCAATTGAAGTGCAACAGGTCGCCT
GGTGCGGCCGAAACAGAGGACCTTGTCAAAATTCAGCATGAGATTCAAGAATTGGGAGGTCTTCAACGTTACCAG
CGAATGTCAACAGTCGGACAGAGTGGTGACAGAGGCGGGGGCAGTGAGAAAGTTTTTATCGAGTGGATGAAGGAG
CTCAAGTTACATGTCAGTGAAATGCAAATCAAATTAAGACTCCTAGAAGTGGGGGCATTGAAGCCAGATAACTTC
ACCTCTTGCACCTCTTGGATCGAGAACACGCCTATCGATTTGCGCCCGCAACATCCCGCTATCCAAGAACAAGAC
TTCCTTCTCTTAGATCCCGTTGAAAATGAGCGCAAATGGGATGCAATCAGTCTCAGCCTCGTATTAAATTTCGTC
CCTCTCGCTGTTGACAGAGGGAGCATGCTACAACTAGCCAATACAATCCTTAAAGACAAGGGCTATCTATTTCTA
GCTCTACCTTTACCGTGCTTGATTAATTCCCGATATATGAGTTTTGAACATTTTACCCGCCTCATGGAAACCCTT
GGATTTTCGGAGCTCAGATGTCGCTGGAAGAAAGGTGGTAAAATGGCGTATTGGCTCTATCAAAAACAACAAAAA
CCTCGACAAGAGGAATTCGGCGGGTTCGTGAAAAAGGTCGTCCTCCGGCACGGAAATCGGAACAATTTTGCGGTG
CTCTTGAAAAATAGCTGA
Transcript >AgabiH97|059200
ATGCCCAAGACCAAGAAACGTAAATTACCCATCTCCAATCCACTTGACAACTACGTTGCGACAAGCAGGCCGCAA
TCCAGCCGCAGTGTTATTCGTCGGTTTCACGTGCTTATCAAAAAAGAAGCTCAATTGAAGTGCAACAGGTCGCCT
GGTGCGGCCGAAACAGAGGACCTTGTCAAAATTCAGCATGAGATTCAAGAATTGGGAGGTCTTCAACGTTACCAG
CGAATGTCAACAGTCGGACAGAGTGGTGACAGAGGCGGGGGCAGTGAGAAAGTTTTTATCGAGTGGATGAAGGAG
CTCAAGTTACATGTCAGTGAAATGCAAATCAAATTAAGACTCCTAGAAGTGGGGGCATTGAAGCCAGATAACTTC
ACCTCTTGCACCTCTTGGATCGAGAACACGCCTATCGATTTGCGCCCGCAACATCCCGCTATCCAAGAACAAGAC
TTCCTTCTCTTAGATCCCGTTGAAAATGAGCGCAAATGGGATGCAATCAGTCTCAGCCTCGTATTAAATTTCGTC
CCTCTCGCTGTTGACAGAGGGAGCATGCTACAACTAGCCAATACAATCCTTAAAGACAAGGGCTATCTATTTCTA
GCTCTACCTTTACCGTGCTTGATTAATTCCCGATATATGAGTTTTGAACATTTTACCCGCCTCATGGAAACCCTT
GGATTTTCGGAGCTCAGATGTCGCTGGAAGAAAGGTGGTAAAATGGCGTATTGGCTCTATCAAAAACAACAAAAA
CCTCGACAAGAGGAATTCGGCGGGTTCGTGAAAAAGGTCGTCCTCCGGCACGGAAATCGGAACAATTTTGCGGTG
CTCTTGAAAAATAGCTGA
Gene >AgabiH97|059200
ATGCCCAAGACCAAGAAACGTAAATTACCCATCTCCAATCCACTTGACAACTACGTTGCGACAAGCAGGCCGCAA
TCCAGCCGCAGTGTTATTCGTCGGTTTCACGTGCTTATCAAAAAAGAAGCTCAATTGAAGTGCAACAGGTCGCCT
GGTGCGGCCGAAACAGAGGACCTTGTCAAAATTCAGCATGAGATTCAAGAATTGGGAGGTCTTCAACGTTACCAG
CGAATGTCAACAGTCGGACAGAGTGGTGACAGAGGCGGGGGCAGTGAGAAAGTTTTTATCGAGTGGATGAAGGAG
CTCAAGTTACATGTCAGTGAAATGCAAATCAAATTAAGGTGCGCCCCACCAAACCTCTCAGTAGACAATACATTA
ATCCAGCCACGCTCTTCAGACTCCTAGAAGTGGGGGCATTGAAGCCAGATAACTTCACCTCTTGCACCTCTTGGA
TCGAGAACACGCCTATCGATTTGCGCCCGCAACATCCCGCTATCCAAGAACAAGACTTCCTTCTCTTAGATCCCG
TTGAAAATGAGCGCAAATGGGATGCAATCAGTCTCAGCCTCGTATTAAATTTCGTCCCTCTCGCTGTTGACAGAG
GTGAGGCTTAGTAGCGGGGCGCCGGAGCCTGTAGAAATAACCTTGCCTAATGTATGAAAAAAGGGAGCATGCTAC
AACTAGCCAATACAATCCTTAAAGACAAGGGCTATCTATTTCTAGCTGTGAGTCCTATTATATGTTCTCCATACC
TCACCCGCTGCTTACTGACCGTTAGCTACCTTTACCGTGCTTGATTAATTCCCGATATATGAGTTTTGAACATTT
TACCCGCCTCATGGAAACCCTTGGATTTTCGGAGCTCAGATGTCGCTGGAAGAAAGGTGGTAAAATGGCGTATTG
GCTCTATCAAAAACAACAAAAACCTCGACAAGAGGAATTCGGCGGGTTCGTGAAAAAGGTCGTCCTCCGGCACGG
AAATCGGAACAATTTTGCGGTGCTCTTGAAAAATAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail