Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|059160
Gene name
Locationscaffold_3:1569381..1571884
Strand+
Gene length (bp)2503
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 2.4E-51 98 400
PF09260 A_amylase_dom_C Alpha-amylase, domain C 2.3E-08 449 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 44 510 2.0E-118
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 38 510 4.0E-113
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 58 510 5.0E-109
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 57 492 1.0E-107
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 47 492 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 44 510 2.0E-118
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 38 510 4.0E-113
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 58 510 5.0E-109
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 57 492 1.0E-107
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 47 492 2.0E-107
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 63 510 2.0E-105
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 21 510 4.0E-105
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 64 510 2.0E-104
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 64 510 2.0E-104
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 64 510 3.0E-103
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 64 510 3.0E-103
sp|O74922|AMY1_SCHPO Alpha-amylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=3 SV=1 40 510 2.0E-97
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 60 510 4.0E-97
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 62 495 6.0E-92
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 64 491 3.0E-86
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 49 510 4.0E-85
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 64 428 8.0E-47
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 146 466 1.0E-36
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 39 427 9.0E-36
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 69 427 4.0E-35
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 35 427 2.0E-34
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 69 427 2.0E-34
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 69 427 3.0E-33
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 65 427 9.0E-33
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 69 504 2.0E-32
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 38 248 6.0E-32
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 69 427 1.0E-31
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 69 543 4.0E-31
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 69 427 8.0E-31
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 69 427 6.0E-30
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 89 410 1.0E-28
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 69 472 2.0E-26
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 68 427 3.0E-26
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 69 427 4.0E-26
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 69 427 9.0E-26
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 56 427 2.0E-25
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 56 427 3.0E-25
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 69 427 7.0E-25
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 40 427 4.0E-24
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 69 505 4.0E-22
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 70 428 7.0E-22
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 61 427 2.0E-21
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 69 466 4.0E-21
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 60 427 5.0E-20
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 69 427 4.0E-19
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 98 406 1.0E-18
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 69 494 3.0E-17
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 82 454 3.0E-15
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 98 406 6.0E-15
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 36 427 1.0E-14
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 82 428 4.0E-14
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 41 428 1.0E-13
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 64 278 1.0E-13
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 64 400 4.0E-12
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 38 428 8.0E-12
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 41 428 2.0E-10
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 95 428 6.0E-10
sp|P00692|AMY_BACAM Alpha-amylase OS=Bacillus amyloliquefaciens PE=1 SV=1 97 398 7.0E-10
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 64 391 9.0E-10
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 99 299 1.0E-09
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 64 181 4.0E-09
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 64 269 1.0E-08
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 56 182 2.0E-08
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 64 181 3.0E-08
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 99 287 5.0E-08
sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 97 309 7.0E-08
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 64 181 1.0E-07
sp|Q54796|DEXB_STRPN Glucan 1,6-alpha-glucosidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dexB PE=3 SV=2 64 181 1.0E-07
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 93 310 1.0E-07
sp|P27932|AMY3A_ORYSJ Alpha-amylase isozyme 3A OS=Oryza sativa subsp. japonica GN=AMY1.2 PE=2 SV=2 97 300 2.0E-07
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 100 399 3.0E-07
sp|P13507|AMT4_PSEST Glucan 1,4-alpha-maltotetraohydrolase OS=Pseudomonas stutzeri GN=amyP PE=1 SV=2 79 289 3.0E-07
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 61 426 3.0E-07
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 107 181 3.0E-07
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 64 391 3.0E-07
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 98 182 7.0E-07
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 98 266 1.0E-06
sp|O04196|ISOA1_ARATH Isoamylase 1, chloroplastic OS=Arabidopsis thaliana GN=ISA1 PE=1 SV=1 98 261 1.0E-06
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 98 266 1.0E-06
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 98 266 1.0E-06
sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 92 264 2.0E-06
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 103 285 3.0E-06
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 103 182 3.0E-06
sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 103 267 5.0E-06
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 62 182 7.0E-06
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 64 181 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004556 alpha-amylase activity Yes
GO:0016052 carbohydrate catabolic process Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0005509 calcium ion binding Yes
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:0003674 molecular_function No
GO:0016160 amylase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|059160
MHHALSSRHVPYLWEIKKSQRRSLCSLSTSLVVFYIPLSLAHSTISLSLFLLFSIARAATADQWRGRSIYQLITD
RFALPNGTDPSACDPAERAYCGGTWNTIRENLDYIQDAGFTAIWISPVNENYDGPRTVYGDAYHGYWIKDFSKLN
NRFGTADDLKALVAELHRREMYIMVDVVINNVMSTSLKPDYSQYFFKDSSMYHPYCPIQWGNTTSEQTCWLGDTK
VPLPDVNTSHPTVIAQYGDWIHDLVQEYQFDGLRIDAAKHVHVDFWPTFAAKAGVFCMGEVFSGVEVDPVAQYQG
PQGLDSVLNYPMYTALVEAFGIPGPGNITAVSTVIEQSQNSFRDTTVLGNFLENQDVPRWHNISVDPQSLYNAMV
LNFMMDGIPVVYYGQEQSFSGSSDPYNREPLWPSQYQQTDAYKFIQTLNQFRNYLVKTDWATQKTQILTASPYGI
AVMKGKIISVVTNIGSPPRNGTDIAVKSPFESSSSMINILTCQQWVVGSRGYLDVQYTKGGFCGNTLSTTVVGNS
TRQNSAASSLHPWRLSAAALFIALTLHWAIKY*
Coding >AgabiH97|059160
ATGCATCATGCTCTAAGCTCTCGCCATGTACCGTACCTATGGGAAATAAAAAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACCTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAACCATCTCTCTCTCCCTCTTT
CTCCTTTTCAGCATCGCACGGGCCGCAACTGCGGACCAATGGCGTGGTCGCTCTATATACCAACTGATTACAGAC
CGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGAACGAGCATACTGTGGTGGGACATGG
AATACGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCTATATGGATAAGTCCCGTGAATGAA
AACTATGATGGTCCCCGTACTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAAC
AATCGTTTCGGCACGGCCGATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTATATTATGGTT
GATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGCCCGATTATTCTCAGTACTTTTTTAAAGACTCTTCC
ATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACACCAAA
GTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGACCTTGTT
CAGGAGTACCAATTTGATGGGCTTCGCATTGACGCCGCCAAGCATGTACACGTCGATTTTTGGCCTACCTTTGCC
GCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTGGAGTCGAAGTTGACCCTGTTGCACAATATCAAGGG
CCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGCATTCCTGGGCCT
GGTAATATAACTGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCGTGACACCACCGTCCTAGGTAAT
TTTCTAGAAAACCAGGATGTTCCCCGCTGGCACAATATATCTGTTGATCCCCAAAGCCTATATAATGCCATGGTC
TTGAATTTCATGATGGATGGCATCCCCGTCGTATATTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCC
TACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCCAGACCCTGAACCAA
TTTCGCAACTATCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATT
GCTGTAATGAAAGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCCCACGAAACGGGACTGATATCGCG
GTGAAGTCTCCTTTTGAATCTAGTTCAAGCATGATTAACATTTTGACCTGCCAACAATGGGTCGTGGGATCGAGA
GGTTATCTTGACGTCCAATATACCAAGGGGGGCTTCTGTGGCAACACGCTCAGTACTACAGTTGTGGGGAATTCT
ACTCGCCAGAACTCTGCTGCATCTTCACTCCACCCGTGGCGTTTATCCGCCGCCGCTCTGTTCATTGCGTTGACT
TTACATTGGGCTATCAAATATTGA
Transcript >AgabiH97|059160
ATGCATCATGCTCTAAGCTCTCGCCATGTACCGTACCTATGGGAAATAAAAAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACCTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAACCATCTCTCTCTCCCTCTTT
CTCCTTTTCAGCATCGCACGGGCCGCAACTGCGGACCAATGGCGTGGTCGCTCTATATACCAACTGATTACAGAC
CGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGAACGAGCATACTGTGGTGGGACATGG
AATACGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCTATATGGATAAGTCCCGTGAATGAA
AACTATGATGGTCCCCGTACTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAAC
AATCGTTTCGGCACGGCCGATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTATATTATGGTT
GATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGCCCGATTATTCTCAGTACTTTTTTAAAGACTCTTCC
ATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACACCAAA
GTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGACCTTGTT
CAGGAGTACCAATTTGATGGGCTTCGCATTGACGCCGCCAAGCATGTACACGTCGATTTTTGGCCTACCTTTGCC
GCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTGGAGTCGAAGTTGACCCTGTTGCACAATATCAAGGG
CCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGCATTCCTGGGCCT
GGTAATATAACTGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCGTGACACCACCGTCCTAGGTAAT
TTTCTAGAAAACCAGGATGTTCCCCGCTGGCACAATATATCTGTTGATCCCCAAAGCCTATATAATGCCATGGTC
TTGAATTTCATGATGGATGGCATCCCCGTCGTATATTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCC
TACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCCAGACCCTGAACCAA
TTTCGCAACTATCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATT
GCTGTAATGAAAGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCCCACGAAACGGGACTGATATCGCG
GTGAAGTCTCCTTTTGAATCTAGTTCAAGCATGATTAACATTTTGACCTGCCAACAATGGGTCGTGGGATCGAGA
GGTTATCTTGACGTCCAATATACCAAGGGGGGCTTCTGTGGCAACACGCTCAGTACTACAGTTGTGGGGAATTCT
ACTCGCCAGAACTCTGCTGCATCTTCACTCCACCCGTGGCGTTTATCCGCCGCCGCTCTGTTCATTGCGTTGACT
TTACATTGGGCTATCAAATATTGA
Gene >AgabiH97|059160
ATGCATCATGCTCTAAGCTCTCGCCATGTACCGTACCTATGGGAAATAAAAAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACCTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAAGTAGCCCATTCGTTGTATAT
CCCTCTCGTTTCTTATGCTTTCTCTAGCCATCTCTCTCTCCCTCTTTCTCCTTTTCAGCATCGCACGGGCCGCAA
CTGCGGACCAATGGCGTGGTCGCTCTATATACCAGTAAAAACCCCTGTTGTGGGCCGACTCTCTTTCGCTGACCC
ATGATCAACTAGACTGATTACAGACCGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGA
ACGAGCATACTGTGGTGGGACATGGAATACGTGTGTTTTGTTCGAATCTCCCCTCCTACTAACTCACCTTAACTT
GGCATCAGGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCTAGTAAATCTCTTTCCTTTCCC
ATACTGTTGTTTCGGTCTGATCACGGCTGCTAGTATGGATAAGTCCCGTGAATGAAAACTATGATGGTCCCCGTA
CTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAACAATCGTTTCGGCACGGCCG
ATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTAAGTTGAAAATCTGACGTATGCCTTCTTCG
CACGACTGATGTCTTCTCACAGGTATATTATGGTTGATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGC
CCGATTATTCTCAGTACTTTTTTAAAGACTCTGTAAGTATAACATTTCCCGCATCCCAGTATCTAACATTTCACA
GTCCATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACAC
CAAAGTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGACCT
TGTTCAGGAGTACCAATTTGATGGGCTTCGCATTGACGGTAAGCCTCAAATATCTGTCGAATAGCTATAACGCTA
ATGCTCCTCCAAGCCGCCAAGTATGTCATGATCTTCGCAGCCACGCTTTGTTGTTGAGGTACTAACTTGTTTCGA
GGCATGTACACGTCGATTTTTGGCCTACCTTTGCCGCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTG
GAGTCGAAGTTGAGTAAGTCGCGCTACATTTTTATTATCGTAGATGCAGCTCATCTCCCACCCAGCCCTGTTGCA
CAATATCAAGGGCCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGC
ATTCCTGGGCCTGGTAATATAACTGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCGTGTACGTTGG
GTCCAAATGTTGTTCTCCTTCATACTCACTCATTTGAGTCAGGACACCACCGTCCTAGGTAATTTTCTAGAAAAC
CAGGATGTTCCCCGCTGGCACAATATATCTGTTGATCCCCAAAGCCTATAGTGAGGTGGTTTATCCAACCACAGA
TCCAGTTTTCTGACCTATGCTGTTCAAGTAATGCCATGGTCTTGAATTTCATGATGGATGGCATCCCCGTCGTAT
ATTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCCGTGTGTAATAATTATTTCATATACTCTACGGTCG
TCTCACATCCATAGTACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCC
AGACCCTGAACCAAGTTCGTCACGAAGATCTATCCTCCTGAGACTGACGTTGACGTTGGACATAGTTTCGCAACT
ATCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATTGCTGTAATGA
AAGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCGTAGGTCCCCCAGACTTCATTATCCTGTACCACC
AGTTGACCTGATGGCCCTTCCATTGCCAGCCACGAAACGGGACTGATATCGCGGTGAAGTCTCCTTTTGAATCTA
GTTCAAGCATGATTAAGTGAGTTACTCACACTTTCTATATGACAAGCGGATGAATATGACGAATTTGCTTAGCAT
TTTGACCTGCCAACAATGGGTCGTGGGATCGAGAGGTTATCTTGACGTCCAATATACCAAGGGGGGTCAGCCCGT
CATTCTTGCGCCAGCTGATTCACTCAATGACTCAGGCTTCTGTGGCAACACGCTCAGTACTACAGTTGTGGGGAA
TTCTACTCGCCAGAACTCTGCTGCATCTTCACTCCACCCGTGGCGTTTATCCGCCGCCGCTCTGTTCATTGCGTT
GACTTTACATTGGGCTATCAAATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail