© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|058780 |
| Gene name | |
| Location | scaffold_3:1481284..1482324 |
| Strand | - |
| Gene length (bp) | 1040 |
| Transcript length (bp) | 657 |
| Coding sequence length (bp) | 657 |
| Protein length (aa) | 219 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00036 | EF-hand_1 | EF hand | 2.0E-06 | 86 | 111 |
| PF00036 | EF-hand_1 | EF hand | 6.3E-06 | 115 | 142 |
| PF13405 | EF-hand_6 | EF-hand domain | 5.5E-06 | 115 | 142 |
| PF13202 | EF-hand_5 | EF hand | 2.0E-04 | 52 | 71 |
| PF13202 | EF-hand_5 | EF hand | 2.6E-04 | 92 | 109 |
| PF13202 | EF-hand_5 | EF hand | 7.2E-02 | 119 | 138 |
| PF13499 | EF-hand_7 | EF-hand domain pair | 1.7E-08 | 53 | 109 |
| PF13833 | EF-hand_8 | EF-hand domain pair | 2.3E-07 | 61 | 111 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5PQ53|PEF1_XENLA | Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 | 10 | 216 | 2.0E-46 |
| sp|P12815|PDCD6_MOUSE | Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 | 49 | 216 | 1.0E-45 |
| sp|O75340|PDCD6_HUMAN | Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 | 49 | 216 | 2.0E-45 |
| sp|Q9UBV8|PEF1_HUMAN | Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 | 33 | 216 | 2.0E-43 |
| sp|Q8BFY6|PEF1_MOUSE | Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 | 42 | 216 | 3.0E-42 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5PQ53|PEF1_XENLA | Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 | 10 | 216 | 2.0E-46 |
| sp|P12815|PDCD6_MOUSE | Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 | 49 | 216 | 1.0E-45 |
| sp|O75340|PDCD6_HUMAN | Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 | 49 | 216 | 2.0E-45 |
| sp|Q9UBV8|PEF1_HUMAN | Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 | 33 | 216 | 2.0E-43 |
| sp|Q8BFY6|PEF1_MOUSE | Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 | 42 | 216 | 3.0E-42 |
| sp|Q641Z8|PEF1_RAT | Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 | 29 | 216 | 6.0E-41 |
| sp|Q6DC93|PEF1_DANRE | Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 | 42 | 216 | 3.0E-39 |
| sp|Q94743|SORCN_SCHJA | Sorcin OS=Schistosoma japonicum PE=2 SV=1 | 49 | 212 | 2.0E-38 |
| sp|P05044|SORCN_CRIGR | Sorcin OS=Cricetulus griseus GN=SRI PE=1 SV=1 | 41 | 217 | 1.0E-30 |
| sp|Q6P069|SORCN_MOUSE | Sorcin OS=Mus musculus GN=Sri PE=1 SV=1 | 41 | 217 | 1.0E-30 |
| sp|Q8W4L0|CML49_ARATH | Probable calcium-binding protein CML49 OS=Arabidopsis thaliana GN=CML49 PE=2 SV=1 | 14 | 215 | 4.0E-30 |
| sp|Q5R4U9|SORCN_PONAB | Sorcin OS=Pongo abelii GN=SRI PE=2 SV=1 | 41 | 217 | 7.0E-29 |
| sp|P30626|SORCN_HUMAN | Sorcin OS=Homo sapiens GN=SRI PE=1 SV=1 | 41 | 217 | 7.0E-29 |
| sp|Q8VC88|GRAN_MOUSE | Grancalcin OS=Mus musculus GN=Gca PE=1 SV=1 | 45 | 216 | 9.0E-28 |
| sp|Q9FYE4|CML50_ARATH | Probable calcium-binding protein CML50 OS=Arabidopsis thaliana GN=CML50 PE=2 SV=1 | 44 | 215 | 3.0E-26 |
| sp|P28676|GRAN_HUMAN | Grancalcin OS=Homo sapiens GN=GCA PE=1 SV=2 | 45 | 211 | 3.0E-24 |
| sp|Q5RAI6|GRAN_PONAB | Grancalcin OS=Pongo abelii GN=GCA PE=2 SV=1 | 45 | 211 | 3.0E-23 |
| sp|Q96L46|CPNS2_HUMAN | Calpain small subunit 2 OS=Homo sapiens GN=CAPNS2 PE=2 SV=2 | 81 | 215 | 2.0E-20 |
| sp|Q92177|CAN3_CHICK | Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 | 81 | 215 | 2.0E-20 |
| sp|Q95YL5|PEFA_DICDI | Penta-EF hand domain-containing protein 1 OS=Dictyostelium discoideum GN=pefA PE=1 SV=1 | 48 | 214 | 2.0E-20 |
| sp|Q9D7J7|CPNS2_MOUSE | Calpain small subunit 2 OS=Mus musculus GN=Capns2 PE=2 SV=1 | 81 | 215 | 2.0E-20 |
| sp|P51186|CAN3_BOVIN | Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 | 81 | 215 | 7.0E-20 |
| sp|P16259|CAN3_RAT | Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 | 81 | 215 | 9.0E-20 |
| sp|Q64691|CAN3_MOUSE | Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 | 81 | 215 | 1.0E-19 |
| sp|O88456|CPNS1_MOUSE | Calpain small subunit 1 OS=Mus musculus GN=Capns1 PE=1 SV=1 | 64 | 215 | 1.0E-19 |
| sp|P43368|CAN3_PIG | Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 | 81 | 215 | 1.0E-19 |
| sp|Q9TTH8|CAN3_SHEEP | Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 | 81 | 215 | 1.0E-19 |
| sp|Q95YL4|PEFB_DICDI | Penta-EF hand domain-containing protein 2 OS=Dictyostelium discoideum GN=pefB PE=1 SV=1 | 48 | 214 | 2.0E-19 |
| sp|P20807|CAN3_HUMAN | Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 | 81 | 215 | 3.0E-19 |
| sp|Q9GLG7|CAN3_MACFA | Calpain-3 OS=Macaca fascicularis GN=CAPN3 PE=2 SV=1 | 81 | 215 | 3.0E-19 |
| sp|Q9ZQH1|CML48_ARATH | Probable calcium-binding protein CML48 OS=Arabidopsis thaliana GN=CML48 PE=2 SV=2 | 2 | 215 | 7.0E-19 |
| sp|P06813|CPNS1_RABIT | Calpain small subunit 1 OS=Oryctolagus cuniculus GN=CAPNS1 PE=1 SV=1 | 64 | 215 | 1.0E-18 |
| sp|P13135|CPNS1_BOVIN | Calpain small subunit 1 OS=Bos taurus GN=CAPNS1 PE=2 SV=1 | 64 | 215 | 2.0E-18 |
| sp|P04574|CPNS1_PIG | Calpain small subunit 1 OS=Sus scrofa GN=CAPNS1 PE=1 SV=1 | 64 | 215 | 2.0E-18 |
| sp|P04632|CPNS1_HUMAN | Calpain small subunit 1 OS=Homo sapiens GN=CAPNS1 PE=1 SV=1 | 64 | 215 | 3.0E-18 |
| sp|Q64537|CPNS1_RAT | Calpain small subunit 1 OS=Rattus norvegicus GN=Capns1 PE=1 SV=3 | 64 | 215 | 6.0E-18 |
| sp|A6NHC0|CAN8_HUMAN | Calpain-8 OS=Homo sapiens GN=CAPN8 PE=2 SV=3 | 81 | 216 | 3.0E-17 |
| sp|Q9VT65|CANB_DROME | Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 | 81 | 211 | 1.0E-16 |
| sp|Q91VA3|CAN8_MOUSE | Calpain-8 OS=Mus musculus GN=Capn8 PE=1 SV=1 | 44 | 216 | 2.0E-16 |
| sp|Q78EJ9|CAN8_RAT | Calpain-8 OS=Rattus norvegicus GN=Capn8 PE=2 SV=1 | 66 | 216 | 6.0E-16 |
| sp|O08529|CAN2_MOUSE | Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=1 SV=4 | 22 | 212 | 6.0E-16 |
| sp|Q92178|CAN2_CHICK | Calpain-2 catalytic subunit OS=Gallus gallus GN=CAPN2 PE=2 SV=3 | 81 | 206 | 1.0E-15 |
| sp|P53238|PEF1_YEAST | Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEF1 PE=1 SV=2 | 53 | 215 | 1.0E-15 |
| sp|P06814|CAN2_RABIT | Calpain-2 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN2 PE=1 SV=1 | 22 | 206 | 2.0E-15 |
| sp|Q27971|CAN2_BOVIN | Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 | 81 | 212 | 4.0E-15 |
| sp|P06815|CAN1_RABIT | Calpain-1 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN1 PE=1 SV=1 | 63 | 216 | 5.0E-15 |
| sp|P35750|CAN1_PIG | Calpain-1 catalytic subunit OS=Sus scrofa GN=CAPN1 PE=2 SV=3 | 64 | 216 | 6.0E-15 |
| sp|Q11002|CANA_DROME | Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 | 81 | 200 | 8.0E-15 |
| sp|Q9GLG2|CAN1_MACFA | Calpain-1 catalytic subunit OS=Macaca fascicularis GN=CAPN1 PE=2 SV=1 | 64 | 216 | 9.0E-15 |
| sp|P07384|CAN1_HUMAN | Calpain-1 catalytic subunit OS=Homo sapiens GN=CAPN1 PE=1 SV=1 | 64 | 216 | 9.0E-15 |
| sp|O35350|CAN1_MOUSE | Calpain-1 catalytic subunit OS=Mus musculus GN=Capn1 PE=1 SV=1 | 64 | 216 | 1.0E-14 |
| sp|P00789|CANX_CHICK | Calpain-1 catalytic subunit OS=Gallus gallus PE=1 SV=2 | 64 | 216 | 1.0E-14 |
| sp|P97571|CAN1_RAT | Calpain-1 catalytic subunit OS=Rattus norvegicus GN=Capn1 PE=1 SV=1 | 63 | 216 | 2.0E-14 |
| sp|Q07009|CAN2_RAT | Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 | 81 | 212 | 2.0E-14 |
| sp|Q5NVS7|CAN1_PONAB | Calpain-1 catalytic subunit OS=Pongo abelii GN=CAPN1 PE=2 SV=1 | 81 | 216 | 2.0E-14 |
| sp|O14815|CAN9_HUMAN | Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 | 83 | 216 | 2.0E-14 |
| sp|Q27970|CAN1_BOVIN | Calpain-1 catalytic subunit OS=Bos taurus GN=CAPN1 PE=1 SV=3 | 64 | 216 | 2.0E-14 |
| sp|P17655|CAN2_HUMAN | Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 | 81 | 206 | 3.0E-14 |
| sp|Q9GLG1|CAN2_MACFA | Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 | 81 | 206 | 3.0E-14 |
| sp|Q9D805|CAN9_MOUSE | Calpain-9 OS=Mus musculus GN=Capn9 PE=2 SV=2 | 77 | 216 | 6.0E-14 |
| sp|Q4V8Q1|CAN11_RAT | Calpain 11 OS=Rattus norvegicus GN=Capn11 PE=2 SV=2 | 81 | 215 | 2.0E-13 |
| sp|P43367|CAN2_PIG | Calpain-2 catalytic subunit (Fragment) OS=Sus scrofa GN=CAPN2 PE=2 SV=2 | 22 | 206 | 3.0E-13 |
| sp|O35920|CAN9_RAT | Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 | 64 | 216 | 4.0E-13 |
| sp|Q9FMP5|CDPKH_ARATH | Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 | 49 | 214 | 4.0E-11 |
| sp|Q3E9C0|CDPKY_ARATH | Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 | 49 | 143 | 1.0E-10 |
| sp|Q6J756|CAN11_MOUSE | Calpain-11 OS=Mus musculus GN=Capn11 PE=1 SV=1 | 66 | 215 | 2.0E-10 |
| sp|Q9ZSA2|CDPKL_ARATH | Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 | 49 | 155 | 5.0E-10 |
| sp|Q1PFH8|CDPKJ_ARATH | Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 | 49 | 144 | 7.0E-10 |
| sp|Q9S9V0|CDPKV_ARATH | Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 | 49 | 141 | 6.0E-09 |
| sp|Q9ZSA4|CDPKR_ARATH | Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 | 49 | 178 | 6.0E-09 |
| sp|Q9C6P3|CDPKX_ARATH | Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 | 49 | 214 | 1.0E-08 |
| sp|Q9SSF8|CDPKU_ARATH | Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 | 49 | 214 | 1.0E-08 |
| sp|A8MX76|CAN14_HUMAN | Calpain-14 OS=Homo sapiens GN=CAPN14 PE=2 SV=2 | 53 | 215 | 2.0E-08 |
| sp|Q38868|CDPK9_ARATH | Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 | 49 | 214 | 2.0E-08 |
| sp|Q9M9V8|CDPKA_ARATH | Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 | 49 | 214 | 3.0E-08 |
| sp|P28582|CDPK_DAUCA | Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 | 49 | 210 | 5.0E-08 |
| sp|Q8RWL2|CDPKT_ARATH | Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 | 49 | 214 | 5.0E-08 |
| sp|Q9ZSA3|CDPKM_ARATH | Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 | 49 | 141 | 5.0E-08 |
| sp|O49717|CDPKF_ARATH | Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 | 49 | 155 | 8.0E-08 |
| sp|Q38869|CDPK4_ARATH | Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 | 20 | 149 | 8.0E-08 |
| sp|P27730|CAN_SCHMA | Calpain OS=Schistosoma mansoni PE=2 SV=1 | 46 | 201 | 9.0E-08 |
| sp|A5A7I8|CDPK5_SOLTU | Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 | 49 | 146 | 9.0E-08 |
| sp|Q5BK10|CAN13_RAT | Calpain-13 OS=Rattus norvegicus GN=Capn13 PE=2 SV=1 | 58 | 215 | 1.0E-07 |
| sp|Q6ZSI9|CAN12_HUMAN | Calpain-12 OS=Homo sapiens GN=CAPN12 PE=2 SV=1 | 83 | 214 | 2.0E-07 |
| sp|P20801|TNNC2_MOUSE | Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 | 53 | 180 | 2.0E-07 |
| sp|P10246|TNNC2_MELGA | Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 | 53 | 142 | 2.0E-07 |
| sp|P02588|TNNC2_CHICK | Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 | 53 | 142 | 3.0E-07 |
| sp|P02587|TNNC2_PIG | Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 | 53 | 180 | 3.0E-07 |
| sp|Q9M101|CDPKN_ARATH | Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 | 49 | 155 | 3.0E-07 |
| sp|P02589|TNNC2_PELES | Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 | 53 | 180 | 3.0E-07 |
| sp|P02586|TNNC2_RABIT | Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 | 53 | 142 | 4.0E-07 |
| sp|Q39016|CDPKB_ARATH | Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 | 20 | 149 | 4.0E-07 |
| sp|Q38873|CDPK7_ARATH | Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 | 53 | 140 | 4.0E-07 |
| sp|Q9SZM3|CDPKQ_ARATH | Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 | 49 | 139 | 5.0E-07 |
| sp|A5A7I7|CDPK4_SOLTU | Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 | 49 | 146 | 5.0E-07 |
| sp|P14533|CABO_DORPE | Squidulin OS=Doryteuthis pealeii PE=1 SV=1 | 48 | 144 | 8.0E-07 |
| sp|P53683|CDPK2_ORYSJ | Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 | 49 | 214 | 9.0E-07 |
| sp|Q8W4I7|CDPKD_ARATH | Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 | 53 | 216 | 9.0E-07 |
| sp|Q9UMQ6|CAN11_HUMAN | Calpain-11 OS=Homo sapiens GN=CAPN11 PE=2 SV=2 | 81 | 215 | 9.0E-07 |
| sp|P02585|TNNC2_HUMAN | Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 | 53 | 142 | 1.0E-06 |
| sp|Q9NZT1|CALL5_HUMAN | Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 | 46 | 214 | 1.0E-06 |
| sp|P63100|CANB1_RAT | Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 | 47 | 188 | 1.0E-06 |
| sp|Q63810|CANB1_MOUSE | Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 | 47 | 188 | 1.0E-06 |
| sp|P63098|CANB1_HUMAN | Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 | 47 | 188 | 1.0E-06 |
| sp|P63099|CANB1_BOVIN | Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 | 47 | 188 | 1.0E-06 |
| sp|P49101|CDPK2_MAIZE | Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 | 49 | 214 | 2.0E-06 |
| sp|P28583|CDPK_SOYBN | Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 | 49 | 143 | 2.0E-06 |
| sp|Q9ZV15|CDPKK_ARATH | Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 | 49 | 143 | 2.0E-06 |
| sp|Q38872|CDPK6_ARATH | Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 | 49 | 139 | 3.0E-06 |
| sp|P81660|TNNC2_ANGAN | Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 | 53 | 142 | 3.0E-06 |
| sp|Q3UW68|CAN13_MOUSE | Calpain-13 OS=Mus musculus GN=Capn13 PE=2 SV=1 | 51 | 215 | 3.0E-06 |
| sp|Q38871|CDPK5_ARATH | Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 | 49 | 139 | 3.0E-06 |
| sp|Q6MZZ7|CAN13_HUMAN | Calpain-13 OS=Homo sapiens GN=CAPN13 PE=1 SV=2 | 27 | 215 | 4.0E-06 |
| sp|Q9SIQ7|CDPKO_ARATH | Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 | 53 | 140 | 5.0E-06 |
| sp|P27482|CALL3_HUMAN | Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 | 48 | 183 | 6.0E-06 |
| sp|Q42396|CDPKC_ARATH | Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 | 49 | 143 | 8.0E-06 |
| sp|Q9FZ75|CML15_ARATH | Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 | 48 | 192 | 8.0E-06 |
| sp|P04109|SPE1A_STRPU | Calcium-binding protein SPEC 1A OS=Strongylocentrotus purpuratus GN=SPEC1 PE=2 SV=3 | 53 | 182 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005509 | calcium ion binding | Yes |
| GO:0046872 | metal ion binding | No |
| GO:0003674 | molecular_function | No |
| GO:0043167 | ion binding | No |
| GO:0005488 | binding | No |
| GO:0043169 | cation binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 48 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 156.51 | 93.85 | 219.17 |
| Initials | Initials knots | 169.68 | 101.35 | 238.01 |
| Pileal_Stipeal_center | Stage I stipe center | 119.73 | 70.69 | 168.76 |
| Pileal_Stipeal_shell | Stage I stipe shell | 81.62 | 46.92 | 116.32 |
| DIF_stipe_center | Stage II stipe center | 98.74 | 57.49 | 139.99 |
| DIF_stipe_shell | Stage II stipe shell | 134.92 | 79.82 | 190.02 |
| DIF_stipe_skin | Stage II stipe skin | 110.76 | 65.16 | 156.37 |
| DIF_cap_skin | Stage II cap skin | 68.85 | 38.86 | 98.84 |
| DIF_cap_tissue | Stage II cap tissue | 66.60 | 37.48 | 95.72 |
| DIF_gill_tissue | Stage II gill tissue | 76.31 | 43.64 | 108.98 |
| YFB_stipe_center | Young fruiting body stipe center | 116.15 | 68.33 | 163.98 |
| YFB_stipe_shell | Young fruiting body stipe shell | 142.87 | 85.25 | 200.49 |
| YFB_stipe_skin | Young fruiting body stipe skin | 88.14 | 50.71 | 125.56 |
| YFB_cap_skin | Young fruiting body cap skin | 81.42 | 46.74 | 116.10 |
| YFB_cap_tissue | Young fruiting body cap tissue | 74.32 | 41.82 | 106.81 |
| YFB_gill_tissue | Young fruiting body gill tissue | 130.68 | 77.38 | 183.97 |
| YFB_veil | Young fruiting body veil | 90.20 | 50.39 | 130.01 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.004548 | yes |
| Casing | YFB_stipe_center | 0.362013 | no |
| Casing | YFB_stipe_shell | 0.846721 | no |
| Casing | YFB_stipe_skin | 0.032266 | yes |
| Casing | YFB_cap_skin | 0.014081 | yes |
| Casing | YFB_cap_tissue | 0.003365 | yes |
| Casing | YFB_gill_tissue | 0.633537 | no |
| Casing | YFB_veil | 0.049882 | yes |
| Casing | Initials | 0.865403 | no |
| Casing | Pileal_Stipeal_center | 0.423390 | no |
| Casing | Pileal_Stipeal_shell | 0.013186 | yes |
| Casing | DIF_stipe_center | 0.107930 | no |
| Casing | DIF_stipe_shell | 0.715442 | no |
| Casing | DIF_stipe_skin | 0.257070 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.168144 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.019715 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.754440 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.901327 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.964468 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.051520 | no |
| DIF_gill_tissue | YFB_veil | 0.704406 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.577595 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.437800 | no |
| YFB_stipe_center | YFB_cap_skin | 0.268970 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.150034 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.797377 | no |
| YFB_stipe_center | YFB_veil | 0.494627 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.087755 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.036911 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.013782 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.853382 | no |
| YFB_stipe_shell | YFB_veil | 0.114271 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.875706 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.700873 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.196992 | no |
| YFB_stipe_skin | YFB_veil | 0.968122 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.865493 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.105864 | no |
| YFB_cap_skin | YFB_veil | 0.841645 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.052135 | no |
| YFB_cap_tissue | YFB_veil | 0.648546 | no |
| YFB_gill_tissue | YFB_veil | 0.248019 | no |
| Initials | DIF_gill_tissue | 0.001625 | yes |
| Initials | YFB_stipe_center | 0.207043 | no |
| Initials | YFB_stipe_shell | 0.654695 | no |
| Initials | YFB_stipe_skin | 0.012274 | yes |
| Initials | YFB_cap_skin | 0.006387 | yes |
| Initials | YFB_cap_tissue | 0.001140 | yes |
| Initials | YFB_gill_tissue | 0.430182 | no |
| Initials | YFB_veil | 0.018624 | yes |
| Initials | Pileal_Stipeal_center | 0.251432 | no |
| Initials | Pileal_Stipeal_shell | 0.004928 | yes |
| Initials | DIF_stipe_center | 0.052135 | no |
| Initials | DIF_stipe_shell | 0.511501 | no |
| Initials | DIF_stipe_skin | 0.131265 | no |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.123358 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.957628 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.655419 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.367653 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.213176 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.109152 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.858624 | no |
| Pileal_Stipeal_center | YFB_veil | 0.422143 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.214129 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.632874 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.792344 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.875651 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.052745 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.036228 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.900928 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.275344 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.038278 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.885804 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.996051 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.858524 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.101215 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.843553 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.644350 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.075382 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.363377 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.694010 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.615446 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.488978 | no |
| DIF_stipe_center | YFB_stipe_center | 0.709071 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.245982 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.817269 | no |
| DIF_stipe_center | YFB_cap_skin | 0.641577 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.436644 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.418456 | no |
| DIF_stipe_center | YFB_veil | 0.861742 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.355606 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.807977 | no |
| DIF_stipe_center | DIF_cap_skin | 0.279275 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.223034 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.038278 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.732490 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.915332 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.158909 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.076803 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.032978 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.953585 | no |
| DIF_stipe_shell | YFB_veil | 0.199624 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.608908 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.011968 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.007782 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.234408 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.932173 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.465448 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.550196 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.361539 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.209844 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.687290 | no |
| DIF_stipe_skin | YFB_veil | 0.606219 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.111482 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.077698 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.841123 | no |
| DIF_cap_skin | YFB_stipe_center | 0.071413 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.005302 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.522767 | no |
| DIF_cap_skin | YFB_cap_skin | 0.701975 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.892508 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.016104 | yes |
| DIF_cap_skin | YFB_veil | 0.473074 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.955717 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.775358 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.055381 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.004548 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.449367 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.628392 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.835415 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.012880 | yes |
| DIF_cap_tissue | YFB_veil | 0.401643 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|058780 MYGRNQPQRNTSYAGHQHGYQQQPHARHHTIHYGAQRPLQPPAGADPQLWNWFSTVDVDRSGSISVQELQSALLN GNWTRFDLDTVKMLMAIFDTDRSGTIDFSEFARLWKYIAEWQNVFRHFDRDRSGSIEGHELAEALRSFNYTLAPS LLTLIEYKYASAPTSGYGPPPGITFDRFVRACVVVKTLTEAFQRYDSDRDGLIQINYDQFMSIVLTTP* |
| Coding | >AgabiH97|058780 ATGTACGGAAGAAATCAACCTCAGCGCAACACGAGCTATGCTGGCCATCAGCACGGCTATCAACAACAACCACAC GCCAGACACCACACAATTCACTACGGCGCCCAAAGGCCACTTCAGCCGCCTGCTGGAGCAGATCCGCAGCTTTGG AATTGGTTTTCTACAGTGGACGTAGATCGATCAGGTTCCATCTCAGTTCAGGAGCTTCAATCTGCTCTTCTCAAT GGGAACTGGACAAGATTCGATCTTGACACGGTGAAGATGCTTATGGCTATCTTCGACACCGATCGGAGTGGTACG ATTGACTTTTCTGAATTTGCGCGTCTTTGGAAATACATCGCGGAATGGCAAAATGTCTTCCGTCATTTTGATAGG GATCGTTCTGGCTCTATCGAGGGGCATGAGTTAGCGGAGGCGCTACGCAGCTTTAACTATACATTGGCGCCCTCG CTTCTGACTTTGATTGAATACAAATACGCTTCGGCACCTACGAGCGGTTACGGCCCTCCCCCGGGAATTACTTTC GATCGTTTCGTGAGAGCTTGTGTTGTTGTCAAGACGCTTACAGAAGCATTTCAGCGTTACGATAGTGACCGCGAT GGTTTGATCCAGATAAACTACGATCAATTCATGTCGATTGTATTAACCACTCCTTGA |
| Transcript | >AgabiH97|058780 ATGTACGGAAGAAATCAACCTCAGCGCAACACGAGCTATGCTGGCCATCAGCACGGCTATCAACAACAACCACAC GCCAGACACCACACAATTCACTACGGCGCCCAAAGGCCACTTCAGCCGCCTGCTGGAGCAGATCCGCAGCTTTGG AATTGGTTTTCTACAGTGGACGTAGATCGATCAGGTTCCATCTCAGTTCAGGAGCTTCAATCTGCTCTTCTCAAT GGGAACTGGACAAGATTCGATCTTGACACGGTGAAGATGCTTATGGCTATCTTCGACACCGATCGGAGTGGTACG ATTGACTTTTCTGAATTTGCGCGTCTTTGGAAATACATCGCGGAATGGCAAAATGTCTTCCGTCATTTTGATAGG GATCGTTCTGGCTCTATCGAGGGGCATGAGTTAGCGGAGGCGCTACGCAGCTTTAACTATACATTGGCGCCCTCG CTTCTGACTTTGATTGAATACAAATACGCTTCGGCACCTACGAGCGGTTACGGCCCTCCCCCGGGAATTACTTTC GATCGTTTCGTGAGAGCTTGTGTTGTTGTCAAGACGCTTACAGAAGCATTTCAGCGTTACGATAGTGACCGCGAT GGTTTGATCCAGATAAACTACGATCAATTCATGTCGATTGTATTAACCACTCCTTGA |
| Gene | >AgabiH97|058780 ATGTACGGAAGAAATCAACCTCAGCGCAACACGAGCTATGCTGGCCATCAGCACGGCTATCAACAACAACCACAC GCCAGACACCACACAATTCACTACGGCGCCCAAAGGCCACTTCAGCCGCCTGCTGGAGCAGATCCGCAGCTTTGG AATTGGTTTTCTACAGTGGACGTAGATCGATCAGGTTCCATCTCAGTTCAGGAGCTTCAATCTGCTCTTCTCAAT GGTATGTTTGCAGCCACTTGTGTGATTCACAGGTTCATAACCATGATTCGTCTCTGCCAGGGAACTGGACAAGTT GAATAACTTTATTCTATTTGCCCCATATCTTTACAATCTCTCCCCAGGATTCGATCTTGACACGGTGAAGATGCT TATGGCTATCTTCGTATGTTTTTGTGTGTGCTATGAGCTCGGGGGATTGTGACTTAGTTATTCTCTCAGGACACC GATCGGAGTGGTACGATTGACTTTTCTGGTTCGTCGAGCGGATATACGCTTGTCCACCACTCTAATTTTCCCGCA GAATTTGCGCGTCTTTGGAAATACATCGCGGAATGGCAAAATGTCTTCCGTCATTTTGATAGGGATCGTTCTGGC TCTATCGAGGGGCATGAGTTAGCGGAGGCGCTACGCAGCTTTAACTATACATTGGCGCCCTCGCTTCTGACTTTG ATTGAATACAAATACGGTAAGTCATTTGAAATTGCTGCCCGACAGTTTACATCGACAAGCCTGAGTCGGTATATA AGCAGCTTCGGCACCTACGAGCGGTTACGGCCCTCCCCCGGGAATTACTTTCGATCGTTTCGTGAGAGCTTGTGT TGTTGTCAAGACGCTTACAGAAGCATTTCAGCGGTGACTATTTCTTGAGCGTTGTGTACATTACTAGAATCTTGC TCACTATCTGTAGTTACGATAGTGACCGCGATGGTTTGATCCAGATAAACTACGATCAATTCATGTCGGTGAGTA TCCATTAGTGTTCCCAAATGCTAGCTCTGATTACCTCTTTGTAGATTGTATTAACCACTCCTTGA |