Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058760
Gene name
Locationscaffold_3:1475738..1477752
Strand+
Gene length (bp)2014
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.1E-18 48 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 2 487 9.0E-32
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 33 507 2.0E-29
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 26 230 2.0E-28
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 27 491 4.0E-27
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 40 209 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 2 487 9.0E-32
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 33 507 2.0E-29
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 26 230 2.0E-28
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 27 491 4.0E-27
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 40 209 4.0E-08
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 39 189 6.0E-08
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 39 194 6.0E-08
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 71 230 3.0E-07
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 39 189 5.0E-07
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 71 232 5.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 27 179 8.0E-07
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 71 230 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 102 121 19
3 126 148 22
4 160 182 22
5 202 224 22
6 308 330 22
7 350 372 22
8 379 401 22
9 416 438 22
10 458 480 22
11 485 507 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058760
MDISEETALLPAVDAQQDAPNDTTPLPKLQLAVLCATRLMDPLTFTQIYPYINQLLSSLNIVSDGSQIGFYSGLV
ESSFAFFQLLVMYQWARTSDVIGRRPVIIIGTAGLAISTVFFGLTSSLSQILIARCLAGLFSGTTAVLHSALGEI
TDQSNQVLAFPVFGLFWPLGNVIGPIIGGALVDPVEHFPQLFGSSAFLRQYPHFLPCLFSGLMALSAALFAHLYL
CETLPQSTSHIYGKSEVGIEQESPRAPPPTCTLVITASSVNTLESRTRITLDTHNNSVRVFAGAGSSTDSEDLTT
RQLFAIPIIGVLCLSGFVLCFVGTAFEAIFVLLCYTSVESGGLSFGAPQIGYALAIAGISSIIIQLAIFPSLLRR
FSHARLYSCFMLLWPVTFAMFPLLHFTISTLGGRSSHGLALVWTEIALLMALSRFAWLSYSVSLVLCKEHAPGPK
SLAKTNALVLFSMSIARAGAPAFVSSIFAWSTEHRIAGGYLWVIIMVLICFLGCLLSKDIVRICKAS*
Coding >AgabiH97|058760
ATGGATATTTCCGAAGAGACTGCTCTCCTCCCAGCCGTCGACGCGCAACAAGATGCGCCCAATGACACAACACCC
CTGCCCAAGTTGCAGCTTGCAGTTCTGTGCGCCACCCGACTTATGGACCCCTTGACCTTCACCCAAATATACCCG
TACATCAACCAGCTCCTCTCTTCGCTCAACATCGTCTCCGACGGGTCGCAAATTGGCTTCTACAGCGGCCTCGTC
GAATCAAGCTTTGCCTTCTTTCAGCTACTTGTCATGTACCAGTGGGCTAGAACTTCCGATGTCATTGGTCGCCGC
CCAGTCATCATTATTGGCACCGCTGGCCTTGCTATATCAACTGTATTCTTTGGTCTAACGTCGAGTCTATCACAA
ATCCTCATTGCCCGATGCCTAGCCGGACTGTTTTCTGGAACCACTGCAGTACTTCACTCGGCTCTGGGTGAAATC
ACTGATCAAAGCAATCAAGTTCTTGCTTTCCCCGTATTTGGTCTCTTTTGGCCGCTTGGTAATGTCATAGGGCCT
ATTATCGGTGGGGCGCTTGTCGATCCTGTTGAGCATTTCCCGCAACTATTCGGCTCTTCCGCGTTTCTTCGACAG
TACCCGCATTTCCTGCCTTGCCTTTTCTCTGGCCTTATGGCCCTATCTGCAGCTCTATTCGCACACCTGTACCTT
TGCGAGACTCTCCCACAGTCTACGTCCCATATTTATGGTAAATCTGAAGTGGGCATCGAACAGGAATCACCGAGA
GCACCACCACCTACGTGCACCCTCGTAATAACAGCTTCCTCAGTCAACACACTCGAATCGCGGACTCGTATAACC
CTCGATACACATAATAACTCCGTGCGGGTATTCGCTGGCGCCGGATCCAGCACGGACTCAGAAGATTTGACGACA
CGGCAACTATTTGCTATTCCTATCATTGGCGTTTTGTGTCTATCCGGTTTTGTTCTGTGCTTCGTTGGCACAGCG
TTTGAGGCTATCTTTGTTTTACTCTGTTACACATCTGTGGAATCTGGCGGTTTATCTTTTGGCGCACCTCAAATT
GGTTACGCACTTGCCATCGCGGGCATTTCTTCAATCATTATTCAATTAGCTATTTTCCCTAGTCTGCTCCGGAGG
TTCTCCCACGCAAGGTTGTACAGCTGCTTCATGCTGTTGTGGCCTGTAACGTTTGCAATGTTTCCCCTGCTTCAT
TTTACGATCTCTACCTTGGGTGGCCGTAGTTCACATGGGCTTGCGCTTGTCTGGACTGAGATTGCATTGTTAATG
GCGCTGTCTAGGTTTGCCTGGTTGTCATATTCTGTCAGTCTTGTTCTCTGCAAGGAGCACGCTCCAGGCCCCAAG
TCCCTTGCGAAGACTAATGCTCTAGTCCTTTTTTCCATGAGCATTGCTAGAGCAGGAGCACCTGCATTCGTTAGT
TCGATCTTTGCTTGGTCTACTGAGCATCGTATTGCAGGAGGCTACTTATGGGTTATCATCATGGTCCTCATATGT
TTTCTGGGATGTTTGTTGTCCAAGGATATCGTGCGTATCTGCAAAGCGTCGTAA
Transcript >AgabiH97|058760
ATGGATATTTCCGAAGAGACTGCTCTCCTCCCAGCCGTCGACGCGCAACAAGATGCGCCCAATGACACAACACCC
CTGCCCAAGTTGCAGCTTGCAGTTCTGTGCGCCACCCGACTTATGGACCCCTTGACCTTCACCCAAATATACCCG
TACATCAACCAGCTCCTCTCTTCGCTCAACATCGTCTCCGACGGGTCGCAAATTGGCTTCTACAGCGGCCTCGTC
GAATCAAGCTTTGCCTTCTTTCAGCTACTTGTCATGTACCAGTGGGCTAGAACTTCCGATGTCATTGGTCGCCGC
CCAGTCATCATTATTGGCACCGCTGGCCTTGCTATATCAACTGTATTCTTTGGTCTAACGTCGAGTCTATCACAA
ATCCTCATTGCCCGATGCCTAGCCGGACTGTTTTCTGGAACCACTGCAGTACTTCACTCGGCTCTGGGTGAAATC
ACTGATCAAAGCAATCAAGTTCTTGCTTTCCCCGTATTTGGTCTCTTTTGGCCGCTTGGTAATGTCATAGGGCCT
ATTATCGGTGGGGCGCTTGTCGATCCTGTTGAGCATTTCCCGCAACTATTCGGCTCTTCCGCGTTTCTTCGACAG
TACCCGCATTTCCTGCCTTGCCTTTTCTCTGGCCTTATGGCCCTATCTGCAGCTCTATTCGCACACCTGTACCTT
TGCGAGACTCTCCCACAGTCTACGTCCCATATTTATGGTAAATCTGAAGTGGGCATCGAACAGGAATCACCGAGA
GCACCACCACCTACGTGCACCCTCGTAATAACAGCTTCCTCAGTCAACACACTCGAATCGCGGACTCGTATAACC
CTCGATACACATAATAACTCCGTGCGGGTATTCGCTGGCGCCGGATCCAGCACGGACTCAGAAGATTTGACGACA
CGGCAACTATTTGCTATTCCTATCATTGGCGTTTTGTGTCTATCCGGTTTTGTTCTGTGCTTCGTTGGCACAGCG
TTTGAGGCTATCTTTGTTTTACTCTGTTACACATCTGTGGAATCTGGCGGTTTATCTTTTGGCGCACCTCAAATT
GGTTACGCACTTGCCATCGCGGGCATTTCTTCAATCATTATTCAATTAGCTATTTTCCCTAGTCTGCTCCGGAGG
TTCTCCCACGCAAGGTTGTACAGCTGCTTCATGCTGTTGTGGCCTGTAACGTTTGCAATGTTTCCCCTGCTTCAT
TTTACGATCTCTACCTTGGGTGGCCGTAGTTCACATGGGCTTGCGCTTGTCTGGACTGAGATTGCATTGTTAATG
GCGCTGTCTAGGTTTGCCTGGTTGTCATATTCTGTCAGTCTTGTTCTCTGCAAGGAGCACGCTCCAGGCCCCAAG
TCCCTTGCGAAGACTAATGCTCTAGTCCTTTTTTCCATGAGCATTGCTAGAGCAGGAGCACCTGCATTCGTTAGT
TCGATCTTTGCTTGGTCTACTGAGCATCGTATTGCAGGAGGCTACTTATGGGTTATCATCATGGTCCTCATATGT
TTTCTGGGATGTTTGTTGTCCAAGGATATCGTGCGTATCTGCAAAGCGTCGTAA
Gene >AgabiH97|058760
ATGGATATTTCCGAAGAGACTGCTCTCCTCCCAGCCGTCGACGCGCAACAAGATGCGCCCAATGACACAACACCC
CTGCCCAAGTTGCAGCTTGCAGTTCTGTGCGCCACCCGACTTATGGACCCCTTGACCTTCACCCAAGTCAGTCCC
ATTTATGCTTCCCAATCACCCAAAATACTGACATCACCGCCAGATATACCCGTACATCAACCAGCTCCTCTCTTC
GCTCAACATCGTCTCCGACGGGTCGCAAATTGGCTTCTACAGCGGCCTCGTCGTACGTCCATTTTGCAATTGAGA
CGTCTTCTTCAACCTCTCTCCAGGAATCAAGCTTTGCCTTCTTTCAGCTACTTGTCATGTACCAGTGGGCTAGAA
CTTCCGGTCAGCCGCATATGACATATCCAAATTTCGTCCAATTTTCTAACAAGCAACACTTCGCTTAGATGTCAT
TGGTCGCCGCCCAGTCATCATTATTGGCACCGCTGGCCTTGCTATATCAACTGTATTCTTTGGTCTAACGTCGAG
TCTATCACAAATCCTCATTGCCCGATGCCTAGGTACGCGATGTTTGTACTGTGTTCCTGATCTGTCTCATTGTCT
CTAGCCGGACTGTTTTCTGGAACCACTGCAGTACTTCACTCGGCTCTGGGTGAAATCACTGATCAAAGCAATCAA
GTTCTTGCTTTCCCCGTATTTGGTCTCTTTTGGCCGCTTGGTAATGTCATAGGGTGATTCCTTTCCATTGTCACT
ATGATCGAGATTTACAACTCTTTCAGGCCTATTATCGGTGGGGCGCTTGTCGATCCTGTTGAGCATTTCCCGCAA
CTATTCGGCTCTTCCGCGTTTCTTCGACAGTACCCGCATTTCCTGCCTTGCCTTTTCTCTGGCCTTATGGCCCTA
TCTGCAGCTCTATTCGCACACCTGTACCTTTGCGAGGTAAATTATATTCAAACATTAAAAACTGTCGCTAACATT
ATAGAAAAGACTCTCCCACAGTCTACGTCCCATATTTATGGTAAATCTGAAGTGGGCATCGAACAGGAATCACCG
AGAGCACCACCACCTACGTGCACCCTCGTAATAACAGCTTCCTCAGTCAACACACTCGAATCGCGGACTCGTATA
ACCCTCGATACACATAATAACTCCGTGCGGGTATTCGCTGGCGCCGGATCCAGCACGGACTCAGAAGATTTGACG
ACACGGCAACTATTTGCTATTCCTATCATTGGCGTTTTGTGTCTATCCGGTTTTGTTCTGTGCTTCGTTGGCACA
GCGTTTGAGGCTATCTTTGTTTTACTCTGTTACACATCTGTGGAATCTGGCGGTTTATCTTTTGGCGTAAGCGTT
TCCTTCGAACCTGAGCCACCAAAGAATTGACTATTCTCAGGCACCTCAAATTGGTTACGCACTTGCCATCGCGGG
CATTTCTTCAATCATTATTCAATTAGCTATTTTCCCTAGTCTGCTCCGGAGGTTCTCCCACGCAAGGTTGTACAG
CTGCTTCATGCTGTTGTGGCCTGTAACGTTTGCAATGTTTCCCCTGCTTCATTTTACGATCTCTACCTTGGGTGG
CCGTAGTTCACATGGGCTTGCGCTTGTCTGGACTGAGATTGCATTGTTAATGGCGCTGTCTAGGTTTGCCTGGTT
GTCATATTCGTGAGTGCAACGCTTACTGAGAGTCAGCTCCCTACTCAACCCGGCATCCAGTGTCAGTCTTGTTCT
CTGCAAGGAGCACGCTCCAGGCCCCAAGTCCCTTGCGAAGACTAATGCTCTAGTCCTTTTTTCCATGAGCATTGC
TAGAGCAGGAGCACCTGCATTCGTTAGGTGATTGTTGATTTGTTAACTGCTCTTTTCGAATAGTCGGCTCATAGA
GCACTACAGTTCGATCTTTGCTTGGTCTACTGAGCATCGTATTGCAGGAGGCTACTTATGGGTTATCATCATGGT
CCTCATATGTTTTCTGGGATGTTTGTTGTCCAAGGATATCGTGCGTATCTGCAAAGCGTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail