Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058730
Gene name
Locationscaffold_3:1470560..1472501
Strand-
Gene length (bp)1941
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 6.8E-24 220 407

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 280 380 9.0E-10
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 280 414 1.0E-09
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 280 414 3.0E-09
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 280 414 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058730
MDDTDTLIALVSSLLNRPVEPEIILETLVITHGDVQRAAEILNDANDSNVGIAGGERKRKQPASLDAWLKNAKSS
KKECIDLTQAEHASSSITTTKPRSNNRMASKSLTKPPTDLMTILRQPHTQEQSKTHRIRGLPPLMLSNPSMVTEH
TPCTLHLSVLPPDLACRLFYVMIGASKKWQRNKWWLFDRVVESPHKTSFFARPMKASGRNVDEWQEAARFWYNGR
MTDPPEEFLPEMEQACEIVEKVVNEELKKRNRYPLEYAGTQGKDLRYNKPVWEANVAAANCYEGAKESVGFHSDQ
LTYLGPYPTIASLSLGTTRVFRLREVIPINQAESRQARTFNIPLTHNSLTIMHASCQERFKHSIPPQSTIDLFRP
TVNPDIATSSKASPGSCVTYPPSNCRINITFRFYRPDFRPQSIPKCDCGVPTILRPDMKSRTDGETEKYWWTCYA
GAQNDGKGCKFWRVMDMEREGRGPCVGDLNSPKTDGRSEAPGSWTLIIDHVVLLHFCDLNLVLLSNSP*
Coding >AgabiH97|058730
ATGGACGACACCGACACGCTCATTGCGCTTGTTTCGAGCTTGCTCAATCGCCCCGTCGAACCTGAAATCATACTA
GAAACGCTTGTAATCACACACGGTGACGTTCAACGCGCTGCTGAGATCCTTAACGACGCCAATGACTCCAATGTT
GGGATTGCTGGAGGAGAAAGGAAGAGGAAACAACCGGCGAGCCTTGACGCATGGCTGAAGAACGCAAAATCTTCA
AAGAAAGAGTGTATAGACCTCACTCAAGCAGAACATGCGTCAAGTTCTATTACTACCACCAAGCCTAGATCTAAT
AATCGGATGGCATCTAAATCGTTAACTAAGCCTCCTACAGACTTGATGACCATCCTGCGACAACCACATACTCAA
GAGCAATCAAAGACACATAGAATCAGAGGTCTACCGCCTCTCATGCTTTCAAATCCTTCTATGGTCACCGAACAT
ACTCCCTGCACGCTTCACCTGTCCGTCCTACCTCCTGACCTTGCGTGCCGACTCTTCTATGTCATGATAGGCGCC
TCCAAGAAATGGCAGCGTAATAAATGGTGGCTATTCGATCGAGTGGTAGAAAGTCCCCATAAGACATCCTTTTTC
GCCAGGCCAATGAAAGCGAGTGGAAGAAACGTCGACGAATGGCAGGAGGCTGCACGATTTTGGTATAACGGACGA
ATGACGGACCCTCCCGAAGAGTTTCTGCCGGAAATGGAGCAAGCGTGCGAAATCGTCGAGAAAGTCGTAAATGAA
GAACTGAAAAAGCGGAATCGTTACCCGCTCGAGTATGCTGGAACCCAAGGGAAAGATTTACGGTATAACAAACCG
GTTTGGGAAGCGAATGTTGCAGCCGCGAATTGTTATGAAGGGGCAAAGGAAAGCGTTGGATTTCATTCCGATCAA
CTGACCTATCTTGGCCCCTACCCGACTATTGCATCGTTAAGTCTAGGTACCACGAGGGTGTTTCGGCTTCGCGAG
GTTATACCTATAAACCAGGCAGAATCTCGACAGGCGCGGACATTTAATATACCTTTAACGCATAATTCTTTAACT
ATCATGCATGCCTCATGTCAAGAAAGGTTCAAACACTCTATTCCACCACAGTCCACAATAGATTTGTTCCGCCCG
ACAGTGAATCCCGACATTGCCACGAGTTCGAAGGCCTCGCCAGGGTCATGTGTTACATATCCCCCATCGAACTGT
AGGATCAATATCACCTTTCGGTTCTATAGGCCGGATTTTCGGCCGCAGAGCATACCCAAATGTGATTGTGGCGTT
CCGACAATCCTGAGACCCGATATGAAGAGTAGGACTGATGGAGAAACCGAAAAATATTGGTGGACTTGCTATGCG
GGTGCCCAGAATGACGGTAAGGGATGCAAGTTTTGGAGAGTCATGGATATGGAAAGAGAGGGTCGTGGACCCTGC
GTAGGGGACTTGAATTCTCCCAAAACTGACGGGAGGAGTGAAGCCCCGGGATCCTGGACTCTCATTATTGACCAC
GTCGTCTTACTCCACTTTTGCGACTTGAACTTGGTCCTTTTGTCAAACAGCCCTTAG
Transcript >AgabiH97|058730
ATGGACGACACCGACACGCTCATTGCGCTTGTTTCGAGCTTGCTCAATCGCCCCGTCGAACCTGAAATCATACTA
GAAACGCTTGTAATCACACACGGTGACGTTCAACGCGCTGCTGAGATCCTTAACGACGCCAATGACTCCAATGTT
GGGATTGCTGGAGGAGAAAGGAAGAGGAAACAACCGGCGAGCCTTGACGCATGGCTGAAGAACGCAAAATCTTCA
AAGAAAGAGTGTATAGACCTCACTCAAGCAGAACATGCGTCAAGTTCTATTACTACCACCAAGCCTAGATCTAAT
AATCGGATGGCATCTAAATCGTTAACTAAGCCTCCTACAGACTTGATGACCATCCTGCGACAACCACATACTCAA
GAGCAATCAAAGACACATAGAATCAGAGGTCTACCGCCTCTCATGCTTTCAAATCCTTCTATGGTCACCGAACAT
ACTCCCTGCACGCTTCACCTGTCCGTCCTACCTCCTGACCTTGCGTGCCGACTCTTCTATGTCATGATAGGCGCC
TCCAAGAAATGGCAGCGTAATAAATGGTGGCTATTCGATCGAGTGGTAGAAAGTCCCCATAAGACATCCTTTTTC
GCCAGGCCAATGAAAGCGAGTGGAAGAAACGTCGACGAATGGCAGGAGGCTGCACGATTTTGGTATAACGGACGA
ATGACGGACCCTCCCGAAGAGTTTCTGCCGGAAATGGAGCAAGCGTGCGAAATCGTCGAGAAAGTCGTAAATGAA
GAACTGAAAAAGCGGAATCGTTACCCGCTCGAGTATGCTGGAACCCAAGGGAAAGATTTACGGTATAACAAACCG
GTTTGGGAAGCGAATGTTGCAGCCGCGAATTGTTATGAAGGGGCAAAGGAAAGCGTTGGATTTCATTCCGATCAA
CTGACCTATCTTGGCCCCTACCCGACTATTGCATCGTTAAGTCTAGGTACCACGAGGGTGTTTCGGCTTCGCGAG
GTTATACCTATAAACCAGGCAGAATCTCGACAGGCGCGGACATTTAATATACCTTTAACGCATAATTCTTTAACT
ATCATGCATGCCTCATGTCAAGAAAGGTTCAAACACTCTATTCCACCACAGTCCACAATAGATTTGTTCCGCCCG
ACAGTGAATCCCGACATTGCCACGAGTTCGAAGGCCTCGCCAGGGTCATGTGTTACATATCCCCCATCGAACTGT
AGGATCAATATCACCTTTCGGTTCTATAGGCCGGATTTTCGGCCGCAGAGCATACCCAAATGTGATTGTGGCGTT
CCGACAATCCTGAGACCCGATATGAAGAGTAGGACTGATGGAGAAACCGAAAAATATTGGTGGACTTGCTATGCG
GGTGCCCAGAATGACGGTAAGGGATGCAAGTTTTGGAGAGTCATGGATATGGAAAGAGAGGGTCGTGGACCCTGC
GTAGGGGACTTGAATTCTCCCAAAACTGACGGGAGGAGTGAAGCCCCGGGATCCTGGACTCTCATTATTGACCAC
GTCGTCTTACTCCACTTTTGCGACTTGAACTTGGTCCTTTTGTCAAACAGCCCTTAG
Gene >AgabiH97|058730
ATGGACGACACCGACACGCTCATTGCGCTTGTTTCGAGCTTGCTCAATCGCCCCGTCGAACCTGAAATCATACTA
GAAACGCTTGTAATCACACACGGTGACGTTCAACGCGCTGCTGAGATCCTTAACGACGCCAATGACTCCAATGTT
GGGATTGCTGGAGGAGAAAGGAAGAGGAAACAACCGGCGAGCCTTGACGCATGGCTGAAGAACGCAAAATCTTCA
AAGAAAGAGTGTATAGACCTCACTCAAGCAGAACATGCGTCAAGTTCTATTACTACCACCAAGCCTAGATCTAAT
AATCGGATGGCATCTAAATCGTTAACTAAGCCTCCTACAGACTTGATGACCATCCTGCGACAACCACATACTCAA
GAGCAATCAAAGACACATAGAATCAGAGGTCTACCGCCTCTCATGCTTTCAAATCCTTCTATGGTCACCGAACAT
ACTCCCTGCACGCTTCACCTGTCCGTCCTACCTCCTGACCTTGCGTGCCGACTCTTCTATGTCATGATAGGCGCC
TCCAAGAAATGGCAGCGTAATAAATGGTGGCTATTCGATCGAGTGGTAGAAAGTCCCCATAAGACATCCTTTTTC
GCCAGGCCAATGAAAGCGAGTGGAAGAAACGTCGACGAATGGCAGGAGGCTGCACGATTTTGGTATGATGCAATC
TATCCCTTACCCTCGTCTTGTCGGTGCATCTCTTGACTCCATGGCATCTAGGTATAACGGACGAATGACGGACCC
TCCCGAAGAGTTTCTGCCGGAAATGGAGCAAGCGTGCGAAATCGTCGAGAAAGTCGTAAATGAAGAACTGAAAAA
GCGGAATCGTTACCCGCTCGAGTATGCTGGAACCCAAGGGAAAGATTTACGGTATAACAAACCGGTTTGGGAAGC
GAATGTTGCAGCCGCGAATTGTTATGAAGGGGCAAAGGAAAGCGTTGGATTTCATTCCGATCAACTGACCTATCT
TGGCCCCTACCCGACTATTGCATCGTTAAGTCTAGGTACGATGTTACATCAAAGCTTGTTCTGACATTGAAATAT
CATTTCTTTTTGTATTAGGTACCACGAGGGTGTTTCGGCTTCGCGAGGTTATACCTATAAACCAGGCAGAATCTC
GACAGGCGCGGACATTTAATATACCTTTAACGCATAATTCTGTGTGTGGCGTTCCTGTCATAATCCCATGTTTCC
CACTAATTTTCGGCATTTGCCTCCCGTGTCATTTCCGCCCGCCTCCAGTTAACTATCATGCATGCCTCATGTCAA
GAAAGGTTCAAACACTCTATTCCACCACAGTCCACAATAGATTTGTTCCGCCCGACAGTGAATCCCGACATTGCC
ACGAGTTCGAAGGCCTCGCCAGGGTCATGTGTTACATATCCCCCATCGAACTGTAGGATCAATATCACCTTTCGG
TTCTATAGGCCGGATTTTCGGCCGCAGAGCATACCCAAATGTGATTGTGGCGTTCCGACAATCCTGAGACCCGAT
ATGAAGAGTAGGACTGATGGAGAAACCGAAAAATATTGGTGGACTTGCTATGCGGGTGCCCAGAATGACGGTAAG
GGATGCAAGTTTTGGAGAGTCATGGATATGGAAAGAGAGGGTCGTGGACCCTGCGTAGGGGACTTGAATTCTCCC
AAAACTGACGGGAGGAGTGAAGGTATGAAGGTTTGAAGTGGCTTTATGTTAATTACCATATCACCTCCCTTCACG
GGACCAGCAATAATGGATCCTTGTTGTTGTCCCACCTAGACGATGCTGCCGAGTGGAGGTTTCATTGATGCCATG
CAGCCCCGGGATCCTGGACTCTCATTATTGACCACGTCGTCTTACTCCACTTTTGCGACTTGAACTTGGTGAGCC
TGGAGGTAATCTGGTTAACAGAATCTTATGTTGACTACTTAGGTCCTTTTGTCAAACAGCCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail