Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058680
Gene name
Locationscaffold_3:1454193..1461395
Strand+
Gene length (bp)7202
Transcript length (bp)6450
Coding sequence length (bp)6450
Protein length (aa) 2150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00310 GATase_2 Glutamine amidotransferases class-II 2.3E-176 61 491
PF01645 Glu_synthase Conserved region in glutamate synthase 9.2E-154 876 1244
PF04898 Glu_syn_central Glutamate synthase central domain 3.7E-112 528 813
PF01493 GXGXG GXGXG motif 3.7E-86 1325 1511
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 5.7E-23 1780 2092
PF14691 Fer4_20 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster 2.5E-21 1657 1766
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.3E-07 1784 1817
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.6E-05 1781 1852

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06434|GLTB_ANTSP Ferredoxin-dependent glutamate synthase OS=Antithamnion sp. GN=gltB PE=3 SV=1 50 1550 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 4 2130 0.0E+00
sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 1635 2121 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 51 1557 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 27 1550 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06434|GLTB_ANTSP Ferredoxin-dependent glutamate synthase OS=Antithamnion sp. GN=gltB PE=3 SV=1 50 1550 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 4 2130 0.0E+00
sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 1635 2121 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 51 1557 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 27 1550 0.0E+00
sp|P55038|GLTS_SYNY3 Ferredoxin-dependent glutamate synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltS PE=1 SV=2 55 1550 0.0E+00
sp|Q1XDB2|GLTB_PYRYE Ferredoxin-dependent glutamate synthase OS=Pyropia yezoensis GN=gltB PE=3 SV=1 45 1550 0.0E+00
sp|Q9ZNZ7|GLTB1_ARATH Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLU1 PE=1 SV=3 25 1550 0.0E+00
sp|Q9T0P4|GLTB2_ARATH Ferredoxin-dependent glutamate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=GLU2 PE=1 SV=2 55 1550 0.0E+00
sp|Q05755|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1 52 1558 0.0E+00
sp|P23225|GLTB_MAIZE Ferredoxin-dependent glutamate synthase, chloroplastic OS=Zea mays GN=GLSF PE=1 SV=1 34 1568 0.0E+00
sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1 38 2115 0.0E+00
sp|Q12680|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2 21 2131 0.0E+00
sp|P51375|GLTB_PORPU Ferredoxin-dependent glutamate synthase OS=Porphyra purpurea GN=gltB PE=3 SV=1 34 1550 0.0E+00
sp|Q0DG35|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2 50 2115 0.0E+00
sp|Q0JKD0|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1 43 2115 0.0E+00
sp|Q9LV03|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=2 SV=2 38 2115 0.0E+00
sp|P55037|GLTB_SYNY3 Ferredoxin-dependent glutamate synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltB PE=1 SV=1 46 1567 0.0E+00
sp|P39812|GLTA_BACSU Glutamate synthase [NADPH] large chain OS=Bacillus subtilis (strain 168) GN=gltA PE=2 SV=3 45 1560 0.0E+00
sp|P96218|GLTB_MYCTU Glutamate synthase [NADPH] large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltB PE=1 SV=3 46 1566 0.0E+00
sp|Q69RJ0|GLTB_ORYSJ Ferredoxin-dependent glutamate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLU PE=2 SV=2 42 1568 0.0E+00
sp|Q43155|GLTB_SPIOL Ferredoxin-dependent glutamate synthase, chloroplastic OS=Spinacia oleracea GN=FdGOGAT PE=1 SV=3 61 1565 0.0E+00
sp|P9WN19|GLTD_MYCTU Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltD PE=1 SV=1 1640 2121 4.0E-134
sp|P9WN18|GLTD_MYCTO Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gltD PE=3 SV=1 1640 2121 4.0E-134
sp|Q08258|GLTB_HORVU Ferredoxin-dependent glutamate synthase (Fragment) OS=Hordeum vulgare PE=1 SV=2 61 502 6.0E-100
sp|Q05756|GLTD_AZOBR Glutamate synthase [NADPH] small chain OS=Azospirillum brasilense GN=gltD PE=1 SV=3 1637 2113 1.0E-84
sp|P09832|GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) GN=gltD PE=1 SV=3 1641 2107 3.0E-75
sp|P37127|AEGA_ECOLI Protein AegA OS=Escherichia coli (strain K12) GN=aegA PE=3 SV=2 1657 2107 2.0E-65
sp|Q46820|YGFT_ECOLI Uncharacterized protein YgfT OS=Escherichia coli (strain K12) GN=ygfT PE=3 SV=2 1656 2110 2.0E-56
sp|O08340|GLTD_RHOSH Putative glutamate synthase [NADPH] small chain OS=Rhodobacter sphaeroides GN=gltD PE=3 SV=1 1718 2115 2.0E-56
sp|O29309|AGLUS_ARCFU Archaeal glutamate synthase [NADPH] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltB PE=3 SV=1 916 1257 2.0E-56
sp|B9KBQ2|AGLUS_THENN Archaeal-type glutamate synthase [NADPH] OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gltB PE=3 SV=1 921 1257 1.0E-55
sp|Q9WYM8|AGLUS_THEMA Archaeal-type glutamate synthase [NADPH] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltB PE=3 SV=1 945 1257 5.0E-55
sp|B1L993|AGLUS_THESQ Archaeal-type glutamate synthase [NADPH] OS=Thermotoga sp. (strain RQ2) GN=gltB PE=3 SV=1 945 1257 5.0E-55
sp|Q3Z7F6|AGLUS_DEHM1 Archaeal-type glutamate synthase [NADPH] OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gltB PE=3 SV=1 929 1251 4.0E-51
sp|Q58746|AGLUS_METJA Archaeal glutamate synthase [NADPH] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1351 PE=3 SV=1 946 1261 1.0E-49
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 1656 2115 9.0E-49
sp|Q74FU5|SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrB PE=1 SV=1 1584 2107 6.0E-27
sp|D7AF64|SFRB_GEOSK NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrB PE=3 SV=1 1584 2107 6.0E-27
sp|O34849|YERD_BACSU Glutamate synthase large subunit-like protein YerD OS=Bacillus subtilis (strain 168) GN=yerD PE=3 SV=1 945 1245 3.0E-23
sp|Q8X645|PRET_ECO57 NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli O157:H7 GN=preT PE=3 SV=1 1676 2117 5.0E-22
sp|P76440|PRET_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) GN=preT PE=1 SV=1 1676 2117 6.0E-22
sp|Q8Z5A6|PRET_SALTI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT homolog OS=Salmonella typhi GN=preT PE=3 SV=1 1676 2114 2.0E-21
sp|Q8ZNL8|PRET_SALTY NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=preT PE=3 SV=1 1676 2114 6.0E-21
sp|Q55FT1|DPYD_DICDI Dihydropyrimidine dehydrogenase [NADP(+)] OS=Dictyostelium discoideum GN=pyd1 PE=2 SV=1 1668 2125 7.0E-19
sp|Q8XD75|YGFK_ECO57 Uncharacterized protein YgfK OS=Escherichia coli O157:H7 GN=ygfK PE=3 SV=1 1682 1940 7.0E-18
sp|O89000|DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Dpyd PE=2 SV=1 1676 2114 1.0E-17
sp|Q46811|YGFK_ECOLI Uncharacterized protein YgfK OS=Escherichia coli (strain K12) GN=ygfK PE=3 SV=1 1682 1940 1.0E-17
sp|Q6NYG8|DPYD_DANRE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Danio rerio GN=dpyd PE=2 SV=1 1668 2121 1.0E-17
sp|Q8CHR6|DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus GN=Dpyd PE=1 SV=1 1676 2114 4.0E-17
sp|Q28007|DPYD_BOVIN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Bos taurus GN=DPYD PE=1 SV=1 1676 2121 3.0E-16
sp|Q5R895|DPYD_PONAB Dihydropyrimidine dehydrogenase [NADP(+)] OS=Pongo abelii GN=DPYD PE=2 SV=1 1676 2114 3.0E-16
sp|Q28943|DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa GN=DPYD PE=1 SV=1 1676 2121 5.0E-16
sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens GN=DPYD PE=1 SV=2 1676 2121 1.0E-15
sp|Q18164|DPYD_CAEEL Dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis elegans GN=dpyd-1 PE=3 SV=2 1656 1947 8.0E-12
sp|A8XKG6|DPYD_CAEBR Probable dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis briggsae GN=dpyd-1 PE=3 SV=2 1656 1947 3.0E-11
sp|Q8W3L1|MFDR_ARATH NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=MFDR PE=1 SV=1 1768 1897 6.0E-10
sp|Q8VQF5|CINB_CITBR Cindoxin reductase OS=Citrobacter braakii GN=cinB PE=3 SV=1 1781 1941 6.0E-10
sp|O87392|GLXD_RHIME Glutamate synthase large subunit-like protein OS=Rhizobium meliloti (strain 1021) GN=glxD PE=3 SV=2 992 1216 3.0E-08
sp|P82861|ADRO_SALFO NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Salvelinus fontinalis GN=fdxr PE=2 SV=1 1754 1897 1.0E-06
sp|P08165|ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus GN=FDXR PE=1 SV=3 1768 1897 1.0E-06
sp|P22570|ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens GN=FDXR PE=1 SV=3 1768 1933 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0015930 glutamate synthase activity Yes
GO:0009064 glutamine family amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0009058 biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043436 oxoacid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058680
MTIHNSQHLATSTSDLPLVSETATLENIDGFHAVKRDENSWAATLPADQGLYSNVNEKDSCGVGFICHIKGERSH
KIVSDARQLLCAMTHRGATGADSRDGDGAGVMTGIPHEFFKREAEMDIGCALPELGEYAVGNIFFKKDDLVQTPA
QQAIFAKIANDLGLRVLGWREVPTDGTILGPAASSREPTILQPFVVLRSHYGDGSSSQCGTFDARHFERQLYVLR
KHATHRIGLSKGFYLCSLASKNIVYKGQLSPSQVYNYYHDLNHVLYRSHFTLVHSRFSTNTFPSWDRAQPLRWAA
HNGEINTVRGNKNWMRAREGVLSSQHFGDQLDLLYPIIETGGSDSAAFDNVLELLVVNGVVTLPEAVMMMIPEAW
QGNEHMEPEKKAFYSWAACLQEPWDGPALFTFSDGRYCGANLDRNGLRPCRFIISNEDIMVCASEVGVIPIAPEK
VVQKGRLKPGRMLLVDTLEGRVVDDKELKHNTASKKDFASWLESNVLQVPKIIKRVKRSHIQLEPTLDDSTLSTD
PKLLAFGYTSEQLNLLMLPMIIGGKEALGSMGNDAPLACMATQPRLIFDYFRQLFAQVTNPPIDSIRESIVMSLE
AYVGPEGNLLDMKPEQCHRILLPSPIISIEEMNAMKNLKSAYVTWPSRTIDITFPKGEGLPGYKAALERVCSEAT
QAIEDGVKVVVLSDRAIGPDRVPLSALIACGGVHHYLTSQKKRAKVALMVETAEAREVHHLCVLVGYGADAICPW
LAIESIHKVVREGLVKSELAVETLFENYRHSVDNGILKVMSKMGISTLQSYKGAQIFEILGLHSEVVDKCFIGSA
SRIQGATFDLLALDAFELHERGWPSRETILPPGMPESGEYHWRDGGEAHINDPSGIASLQDAVREKNQDAYDSYA
RNANEQASRVHLRGMLDFRYENTVAIPIEQVEPWNEIVRRFVTGAMSYGSISMEAHTTLAIAMNRLSGKSNTGEG
GEDAERSKVSTNGDTMRSAIKQIASGRFGVTANYLADADELQIKMAQGAKPGEGGELPGHKVSTSIARTRHSTAG
VGLISPPPHHDIYSIEDLKQLIYDLKCSNPRSRISVKLVSEVGVGIVASGVAKAKADHILISAHDGGTGASRWTG
IKYAGLPWELGLAETHQTLVLNDLRGRVTVQTDGQIRTGRDIAIACLLGAEEWGFATTPLIAMGCIMMRKCHLNT
CPVGIATQDPQLRAKFAGQPEQVINFFYYLAEELRGIMAKLGFRTINEMVGRADMLKVNEKLRTPKTAYLDLSAI
LKPAWQMRPGAATHRVRQQDHKLYIRLDNKFIDEAEPALAKGLPVHIECDVTNTDRALGTSLSYRISKLYGEEGL
PKDTIHIRMRGSAGQSCGAFLAPGITIELEGDANDYVGKGLSGGRLVVYPPKQSTFKAEENIIIGNVCLYGATSG
EAFIRGIAAERFAVRNSGANAVVEGCGDHGCEYMTGGRVVVLGFTGRNFAAGMSGGIAYVLDMAHTFASKVNMEM
VELGKVTDPREIAALRSLIEDHRHYTGSEIADRVLHDFHHILPLFVRVMPSDYRRVLEEQAVREKEEKQRLSVID
LVPSRTASQVDLASEALEDILLHKTQSSTSISKPRHEPSVTDLEDSLVDESTNKKRLDKLDKLRGFMKYKRLGEA
YRPPRKRVKDWKEISGRLTESELKYQSARCMDCGVPFCQSDTGCPISNIIPKWNDLVFKGQWQDALNRLLMTNNF
PEFTGRVCPAPCEGACVLGINEHPVGIKSIECAIIDKGFEMGWMTPRLPASRSGKSVAIIGSGPSGLACADQLNK
AGHWVTVYDRNDRMGGLLMYGIPNMKLDKNIVQRRIDLMAAEGITFIPNAHVGVDVDVNELRDQHDAVVVCTGAT
WPRDLKLPNRSANGIHFAMEYLQLNTKSLLDSELQDNSYISAKGKEVIVIGGGDTGNDCIGTAMRHGAKSVVNFE
LLPKPPASRGRDNPWPQWPRIFRADYGHIEVAAHFGHDPREYCISTKDFVVDEDNNLTGLNTVRVEWTKDSGGRW
KMEEVPGSEKFFPAQLVFLALGFMGPEANVVKDLGLKQDARSNIQTPPKKYCTNVEGVFAAGDCRRGQSLIVWGI
NEGREAAAEVDAHLSGSTRLPRAGGIKTRTFVPPPSKVVQNGHPIEVQA*
Coding >AgabiH97|058680
ATGACTATTCACAATTCCCAACATCTTGCTACATCTACTTCTGATTTACCCCTTGTATCTGAGACCGCCACTTTA
GAAAACATTGACGGATTTCACGCAGTAAAACGCGACGAAAACTCTTGGGCTGCTACACTCCCAGCCGATCAGGGC
CTCTACAGTAATGTGAACGAAAAAGACTCGTGTGGTGTTGGCTTTATCTGCCACATCAAAGGTGAACGCAGCCAC
AAGATAGTGTCTGATGCTCGTCAGCTATTATGTGCCATGACTCACAGAGGTGCAACTGGAGCTGATAGCCGTGAT
GGCGATGGTGCGGGTGTGATGACCGGCATTCCTCACGAGTTTTTCAAACGAGAGGCGGAAATGGACATCGGTTGC
GCTCTCCCAGAGCTTGGGGAATATGCTGTTGGGAACATTTTCTTCAAGAAGGATGACCTCGTGCAAACACCGGCG
CAACAAGCCATATTTGCCAAGATTGCCAACGACCTTGGTCTCCGTGTGCTTGGCTGGCGAGAGGTACCCACTGAC
GGTACTATTCTCGGGCCCGCCGCTAGCAGCAGAGAACCTACCATATTGCAACCTTTTGTTGTCCTCCGTAGTCAC
TATGGCGATGGAAGTTCTAGCCAATGTGGCACTTTTGATGCTCGCCACTTCGAGCGTCAATTGTATGTCCTTCGT
AAGCATGCTACCCATCGTATTGGTCTCTCCAAAGGATTTTACTTATGTTCTTTGGCATCGAAGAACATCGTCTAC
AAAGGCCAACTTTCCCCATCTCAAGTATACAACTACTACCATGATTTGAACCATGTTTTGTACCGATCACACTTC
ACACTGGTACATTCCCGTTTCTCCACCAATACGTTCCCGAGTTGGGACCGTGCCCAACCTTTGAGATGGGCTGCT
CACAATGGTGAGATAAACACCGTGCGAGGAAACAAGAATTGGATGCGTGCGCGTGAAGGTGTATTATCGTCACAA
CACTTTGGTGACCAATTGGATCTTCTTTATCCCATTATCGAAACGGGTGGCTCCGATTCCGCCGCCTTCGACAAC
GTCTTAGAACTTTTGGTCGTTAATGGTGTCGTAACGTTACCTGAGGCTGTCATGATGATGATACCCGAAGCTTGG
CAGGGCAATGAACATATGGAGCCGGAGAAAAAGGCATTTTACAGCTGGGCGGCCTGTCTCCAGGAGCCATGGGAT
GGTCCTGCGCTTTTCACCTTCAGTGACGGTCGTTATTGTGGTGCCAACCTTGATCGAAATGGTCTTCGTCCGTGT
CGATTCATAATCTCCAACGAAGACATCATGGTCTGTGCTTCTGAAGTTGGGGTCATTCCCATTGCGCCCGAAAAA
GTGGTGCAAAAAGGTCGCCTGAAGCCTGGTCGTATGTTATTAGTTGACACTTTAGAGGGACGTGTTGTCGACGAC
AAGGAGCTCAAGCACAATACCGCATCAAAGAAGGATTTTGCTTCCTGGCTCGAGTCGAACGTTTTGCAGGTGCCG
AAGATTATAAAACGCGTTAAGCGCAGCCACATACAACTGGAACCCACTCTTGATGATTCTACTCTAAGCACTGAT
CCAAAATTGCTTGCATTCGGTTACACCTCGGAGCAGCTTAACCTTCTCATGCTTCCTATGATCATCGGTGGGAAG
GAAGCTCTTGGATCAATGGGCAATGACGCTCCGCTGGCATGCATGGCAACACAACCCCGTCTCATTTTCGATTAC
TTCCGCCAGTTATTTGCGCAGGTCACGAATCCGCCTATTGATTCCATCCGGGAGAGTATTGTGATGTCTTTAGAA
GCATACGTTGGACCTGAAGGTAATCTGCTTGATATGAAGCCCGAGCAGTGCCATCGTATTCTCCTCCCCTCTCCT
ATCATCTCCATCGAAGAAATGAATGCTATGAAGAACTTGAAGTCTGCTTATGTTACCTGGCCTTCTCGTACCATT
GACATAACATTCCCCAAGGGCGAAGGACTTCCTGGCTATAAGGCAGCCTTGGAGCGCGTCTGTAGTGAGGCAACG
CAGGCAATTGAAGATGGGGTCAAAGTCGTCGTTTTGAGTGACCGCGCCATTGGTCCTGACCGTGTTCCTCTTTCT
GCATTGATCGCCTGCGGTGGTGTTCATCATTATTTGACGTCCCAAAAAAAGCGCGCCAAGGTTGCTCTCATGGTC
GAAACTGCCGAAGCTCGCGAAGTTCATCACCTCTGCGTCCTGGTTGGTTATGGGGCTGACGCTATATGCCCGTGG
TTAGCAATAGAGTCGATTCACAAAGTTGTTCGCGAGGGACTCGTAAAATCTGAGCTTGCTGTTGAGACACTCTTC
GAAAATTATCGCCACTCGGTCGACAATGGTATTCTGAAAGTCATGTCAAAAATGGGGATCTCTACCCTCCAATCA
TACAAGGGTGCCCAAATATTCGAGATCTTAGGGTTGCACAGTGAGGTCGTCGACAAGTGTTTCATTGGTTCTGCT
AGTCGAATCCAGGGCGCTACATTTGACTTGCTCGCGTTGGATGCGTTTGAGCTTCATGAACGTGGATGGCCCAGC
AGGGAAACCATACTCCCCCCTGGTATGCCGGAATCTGGTGAATACCATTGGCGCGATGGTGGAGAGGCTCACATC
AACGATCCATCTGGCATCGCCAGTCTTCAGGATGCTGTCCGTGAAAAAAACCAGGATGCCTATGATTCATATGCT
CGCAATGCCAATGAACAGGCGAGCAGAGTCCATCTTCGTGGTATGCTTGATTTCCGTTACGAAAATACCGTCGCT
ATCCCTATCGAACAAGTCGAGCCCTGGAACGAGATTGTTCGTCGCTTTGTCACTGGCGCCATGTCTTATGGGTCT
ATCTCGATGGAGGCACATACTACCCTTGCCATTGCCATGAACCGATTAAGTGGTAAATCTAACACTGGTGAGGGA
GGCGAAGATGCCGAGCGTTCTAAAGTCTCCACCAACGGTGATACAATGCGCTCTGCCATCAAGCAGATCGCATCT
GGTCGTTTCGGTGTCACGGCCAATTATTTGGCTGATGCTGATGAGCTTCAAATAAAGATGGCCCAAGGGGCAAAA
CCTGGAGAAGGTGGCGAGCTTCCTGGTCATAAAGTTTCCACCTCTATAGCTCGCACCCGGCATTCTACAGCCGGT
GTGGGGCTGATTTCTCCCCCGCCACATCACGACATTTACTCAATCGAGGATCTAAAACAGCTCATCTATGATCTC
AAGTGTTCCAATCCACGTTCTCGTATCTCTGTTAAACTTGTTTCAGAGGTTGGAGTCGGTATTGTTGCTAGCGGT
GTTGCTAAGGCTAAGGCTGACCATATTCTAATTTCTGCCCACGATGGTGGAACTGGCGCCTCCCGATGGACGGGC
ATCAAATATGCCGGTCTTCCCTGGGAGCTTGGTCTGGCCGAGACCCATCAGACTCTTGTTCTCAATGACTTACGT
GGTCGTGTAACTGTTCAAACAGACGGTCAGATTCGAACGGGCAGGGACATTGCAATCGCCTGTCTGCTAGGTGCT
GAGGAGTGGGGTTTCGCTACTACACCACTAATTGCCATGGGTTGTATCATGATGAGAAAATGTCATCTCAATACG
TGCCCCGTAGGTATTGCTACACAAGATCCCCAACTTCGAGCGAAGTTTGCCGGCCAACCCGAGCAGGTTATCAAC
TTTTTCTACTATCTTGCCGAAGAACTTCGTGGCATAATGGCCAAGCTTGGTTTCCGCACTATCAATGAAATGGTC
GGCAGAGCTGACATGCTCAAGGTCAATGAAAAGCTACGCACACCTAAGACTGCGTACCTTGATCTCTCGGCTATC
CTCAAGCCAGCATGGCAGATGCGCCCTGGTGCTGCCACTCATCGCGTCCGTCAACAAGATCATAAGCTTTACATC
CGCCTCGATAATAAATTCATAGACGAGGCTGAACCTGCGCTCGCTAAGGGCCTGCCTGTGCACATCGAATGCGAC
GTGACAAACACCGATCGCGCCCTCGGAACTTCTCTGTCTTATCGCATCTCGAAGCTTTACGGGGAGGAGGGTCTC
CCGAAGGATACCATCCATATTCGTATGAGGGGGTCTGCTGGGCAGTCATGCGGAGCCTTCCTTGCCCCAGGTATC
ACTATCGAGTTGGAGGGTGATGCTAATGATTACGTTGGAAAGGGTCTCTCTGGTGGAAGACTCGTTGTCTACCCT
CCGAAGCAGTCAACATTCAAAGCGGAAGAGAACATCATCATTGGGAATGTCTGTTTATACGGTGCCACTTCTGGT
GAAGCGTTTATTCGCGGAATTGCTGCAGAACGTTTTGCTGTCCGTAATTCGGGTGCTAACGCTGTCGTAGAGGGT
TGCGGTGATCACGGCTGTGAATATATGACTGGCGGCCGTGTCGTTGTACTTGGTTTCACTGGCCGCAACTTTGCC
GCTGGAATGAGTGGAGGTATTGCCTACGTTCTGGATATGGCCCACACTTTTGCCTCGAAGGTGAATATGGAAATG
GTCGAACTAGGCAAGGTAACGGATCCTCGTGAAATAGCTGCGCTGCGTAGCCTGATCGAAGACCATCGTCACTAT
ACCGGATCCGAAATTGCAGATCGTGTTCTTCATGACTTCCATCACATTCTTCCCCTCTTCGTTCGGGTCATGCCT
TCAGACTACAGGCGAGTGTTAGAGGAGCAAGCAGTACGTGAAAAGGAGGAGAAACAGCGTCTCAGCGTTATTGAT
CTCGTCCCCTCTCGAACCGCCAGCCAGGTAGATCTGGCATCTGAAGCTCTCGAGGATATCTTATTACACAAAACG
CAATCCTCCACTTCCATATCTAAACCGCGTCATGAACCGTCTGTGACTGATCTCGAAGACTCCCTCGTTGATGAA
TCGACAAACAAGAAGCGTCTCGACAAACTCGATAAATTGCGTGGCTTCATGAAATACAAGCGTCTTGGAGAAGCT
TATCGCCCTCCTCGTAAGCGCGTCAAAGATTGGAAGGAAATTTCCGGACGCCTAACTGAGAGCGAGCTTAAATAC
CAATCTGCACGCTGCATGGATTGTGGTGTTCCGTTCTGTCAGTCAGATACTGGTTGTCCCATTTCCAACATTATT
CCCAAGTGGAATGACCTAGTGTTCAAGGGACAATGGCAAGATGCCCTTAATCGTCTCCTGATGACCAACAACTTC
CCTGAGTTCACTGGTCGTGTTTGTCCAGCTCCTTGCGAAGGTGCTTGTGTTCTGGGAATCAATGAGCATCCCGTA
GGCATCAAGAGCATCGAATGTGCGATAATTGACAAGGGATTCGAGATGGGTTGGATGACACCTCGTCTACCGGCT
TCCAGGAGTGGAAAGAGCGTCGCTATCATTGGATCTGGCCCCTCGGGTCTTGCTTGCGCTGATCAGCTGAATAAA
GCAGGGCATTGGGTTACAGTGTACGATCGCAACGATCGCATGGGAGGCCTTCTCATGTACGGAATTCCTAACATG
AAGCTGGACAAAAATATCGTACAAAGACGTATTGACCTTATGGCTGCCGAGGGCATTACTTTCATCCCTAACGCT
CACGTCGGTGTCGATGTCGATGTGAACGAATTGCGTGATCAACATGACGCGGTTGTCGTTTGTACTGGTGCCACT
TGGCCTCGCGACCTCAAATTACCAAATCGAAGTGCCAATGGTATTCATTTCGCTATGGAGTATCTCCAGTTGAAT
ACAAAGTCGTTGTTGGATTCGGAACTCCAGGATAATTCGTACATCAGCGCTAAAGGCAAGGAAGTTATTGTCATC
GGTGGCGGAGATACTGGTAATGATTGTATCGGTACTGCAATGCGTCATGGTGCCAAATCCGTGGTCAATTTTGAG
TTGCTTCCAAAGCCACCTGCATCGCGCGGCCGTGATAATCCTTGGCCGCAATGGCCTCGTATTTTCCGGGCTGAC
TATGGTCACATTGAAGTTGCTGCTCATTTCGGGCACGATCCCCGTGAATATTGCATATCTACCAAAGATTTTGTC
GTTGATGAGGACAACAACCTCACTGGATTAAACACTGTCCGTGTCGAGTGGACCAAAGATAGTGGTGGTCGCTGG
AAAATGGAGGAAGTCCCAGGATCGGAGAAGTTTTTCCCCGCCCAGCTTGTCTTCCTTGCCCTCGGTTTTATGGGT
CCCGAAGCCAATGTTGTCAAAGATCTCGGCCTCAAGCAAGATGCTCGTTCTAACATCCAAACTCCTCCCAAGAAA
TATTGCACAAACGTCGAGGGCGTATTTGCTGCTGGTGATTGCAGACGCGGTCAATCCCTGATTGTTTGGGGCATT
AACGAGGGGCGCGAAGCTGCTGCCGAAGTTGACGCTCATCTGAGTGGTTCAACCAGGCTACCGCGTGCAGGAGGT
ATTAAGACCAGGACTTTTGTTCCGCCTCCAAGCAAAGTGGTCCAGAACGGCCATCCAATCGAGGTGCAGGCTTAA
Transcript >AgabiH97|058680
ATGACTATTCACAATTCCCAACATCTTGCTACATCTACTTCTGATTTACCCCTTGTATCTGAGACCGCCACTTTA
GAAAACATTGACGGATTTCACGCAGTAAAACGCGACGAAAACTCTTGGGCTGCTACACTCCCAGCCGATCAGGGC
CTCTACAGTAATGTGAACGAAAAAGACTCGTGTGGTGTTGGCTTTATCTGCCACATCAAAGGTGAACGCAGCCAC
AAGATAGTGTCTGATGCTCGTCAGCTATTATGTGCCATGACTCACAGAGGTGCAACTGGAGCTGATAGCCGTGAT
GGCGATGGTGCGGGTGTGATGACCGGCATTCCTCACGAGTTTTTCAAACGAGAGGCGGAAATGGACATCGGTTGC
GCTCTCCCAGAGCTTGGGGAATATGCTGTTGGGAACATTTTCTTCAAGAAGGATGACCTCGTGCAAACACCGGCG
CAACAAGCCATATTTGCCAAGATTGCCAACGACCTTGGTCTCCGTGTGCTTGGCTGGCGAGAGGTACCCACTGAC
GGTACTATTCTCGGGCCCGCCGCTAGCAGCAGAGAACCTACCATATTGCAACCTTTTGTTGTCCTCCGTAGTCAC
TATGGCGATGGAAGTTCTAGCCAATGTGGCACTTTTGATGCTCGCCACTTCGAGCGTCAATTGTATGTCCTTCGT
AAGCATGCTACCCATCGTATTGGTCTCTCCAAAGGATTTTACTTATGTTCTTTGGCATCGAAGAACATCGTCTAC
AAAGGCCAACTTTCCCCATCTCAAGTATACAACTACTACCATGATTTGAACCATGTTTTGTACCGATCACACTTC
ACACTGGTACATTCCCGTTTCTCCACCAATACGTTCCCGAGTTGGGACCGTGCCCAACCTTTGAGATGGGCTGCT
CACAATGGTGAGATAAACACCGTGCGAGGAAACAAGAATTGGATGCGTGCGCGTGAAGGTGTATTATCGTCACAA
CACTTTGGTGACCAATTGGATCTTCTTTATCCCATTATCGAAACGGGTGGCTCCGATTCCGCCGCCTTCGACAAC
GTCTTAGAACTTTTGGTCGTTAATGGTGTCGTAACGTTACCTGAGGCTGTCATGATGATGATACCCGAAGCTTGG
CAGGGCAATGAACATATGGAGCCGGAGAAAAAGGCATTTTACAGCTGGGCGGCCTGTCTCCAGGAGCCATGGGAT
GGTCCTGCGCTTTTCACCTTCAGTGACGGTCGTTATTGTGGTGCCAACCTTGATCGAAATGGTCTTCGTCCGTGT
CGATTCATAATCTCCAACGAAGACATCATGGTCTGTGCTTCTGAAGTTGGGGTCATTCCCATTGCGCCCGAAAAA
GTGGTGCAAAAAGGTCGCCTGAAGCCTGGTCGTATGTTATTAGTTGACACTTTAGAGGGACGTGTTGTCGACGAC
AAGGAGCTCAAGCACAATACCGCATCAAAGAAGGATTTTGCTTCCTGGCTCGAGTCGAACGTTTTGCAGGTGCCG
AAGATTATAAAACGCGTTAAGCGCAGCCACATACAACTGGAACCCACTCTTGATGATTCTACTCTAAGCACTGAT
CCAAAATTGCTTGCATTCGGTTACACCTCGGAGCAGCTTAACCTTCTCATGCTTCCTATGATCATCGGTGGGAAG
GAAGCTCTTGGATCAATGGGCAATGACGCTCCGCTGGCATGCATGGCAACACAACCCCGTCTCATTTTCGATTAC
TTCCGCCAGTTATTTGCGCAGGTCACGAATCCGCCTATTGATTCCATCCGGGAGAGTATTGTGATGTCTTTAGAA
GCATACGTTGGACCTGAAGGTAATCTGCTTGATATGAAGCCCGAGCAGTGCCATCGTATTCTCCTCCCCTCTCCT
ATCATCTCCATCGAAGAAATGAATGCTATGAAGAACTTGAAGTCTGCTTATGTTACCTGGCCTTCTCGTACCATT
GACATAACATTCCCCAAGGGCGAAGGACTTCCTGGCTATAAGGCAGCCTTGGAGCGCGTCTGTAGTGAGGCAACG
CAGGCAATTGAAGATGGGGTCAAAGTCGTCGTTTTGAGTGACCGCGCCATTGGTCCTGACCGTGTTCCTCTTTCT
GCATTGATCGCCTGCGGTGGTGTTCATCATTATTTGACGTCCCAAAAAAAGCGCGCCAAGGTTGCTCTCATGGTC
GAAACTGCCGAAGCTCGCGAAGTTCATCACCTCTGCGTCCTGGTTGGTTATGGGGCTGACGCTATATGCCCGTGG
TTAGCAATAGAGTCGATTCACAAAGTTGTTCGCGAGGGACTCGTAAAATCTGAGCTTGCTGTTGAGACACTCTTC
GAAAATTATCGCCACTCGGTCGACAATGGTATTCTGAAAGTCATGTCAAAAATGGGGATCTCTACCCTCCAATCA
TACAAGGGTGCCCAAATATTCGAGATCTTAGGGTTGCACAGTGAGGTCGTCGACAAGTGTTTCATTGGTTCTGCT
AGTCGAATCCAGGGCGCTACATTTGACTTGCTCGCGTTGGATGCGTTTGAGCTTCATGAACGTGGATGGCCCAGC
AGGGAAACCATACTCCCCCCTGGTATGCCGGAATCTGGTGAATACCATTGGCGCGATGGTGGAGAGGCTCACATC
AACGATCCATCTGGCATCGCCAGTCTTCAGGATGCTGTCCGTGAAAAAAACCAGGATGCCTATGATTCATATGCT
CGCAATGCCAATGAACAGGCGAGCAGAGTCCATCTTCGTGGTATGCTTGATTTCCGTTACGAAAATACCGTCGCT
ATCCCTATCGAACAAGTCGAGCCCTGGAACGAGATTGTTCGTCGCTTTGTCACTGGCGCCATGTCTTATGGGTCT
ATCTCGATGGAGGCACATACTACCCTTGCCATTGCCATGAACCGATTAAGTGGTAAATCTAACACTGGTGAGGGA
GGCGAAGATGCCGAGCGTTCTAAAGTCTCCACCAACGGTGATACAATGCGCTCTGCCATCAAGCAGATCGCATCT
GGTCGTTTCGGTGTCACGGCCAATTATTTGGCTGATGCTGATGAGCTTCAAATAAAGATGGCCCAAGGGGCAAAA
CCTGGAGAAGGTGGCGAGCTTCCTGGTCATAAAGTTTCCACCTCTATAGCTCGCACCCGGCATTCTACAGCCGGT
GTGGGGCTGATTTCTCCCCCGCCACATCACGACATTTACTCAATCGAGGATCTAAAACAGCTCATCTATGATCTC
AAGTGTTCCAATCCACGTTCTCGTATCTCTGTTAAACTTGTTTCAGAGGTTGGAGTCGGTATTGTTGCTAGCGGT
GTTGCTAAGGCTAAGGCTGACCATATTCTAATTTCTGCCCACGATGGTGGAACTGGCGCCTCCCGATGGACGGGC
ATCAAATATGCCGGTCTTCCCTGGGAGCTTGGTCTGGCCGAGACCCATCAGACTCTTGTTCTCAATGACTTACGT
GGTCGTGTAACTGTTCAAACAGACGGTCAGATTCGAACGGGCAGGGACATTGCAATCGCCTGTCTGCTAGGTGCT
GAGGAGTGGGGTTTCGCTACTACACCACTAATTGCCATGGGTTGTATCATGATGAGAAAATGTCATCTCAATACG
TGCCCCGTAGGTATTGCTACACAAGATCCCCAACTTCGAGCGAAGTTTGCCGGCCAACCCGAGCAGGTTATCAAC
TTTTTCTACTATCTTGCCGAAGAACTTCGTGGCATAATGGCCAAGCTTGGTTTCCGCACTATCAATGAAATGGTC
GGCAGAGCTGACATGCTCAAGGTCAATGAAAAGCTACGCACACCTAAGACTGCGTACCTTGATCTCTCGGCTATC
CTCAAGCCAGCATGGCAGATGCGCCCTGGTGCTGCCACTCATCGCGTCCGTCAACAAGATCATAAGCTTTACATC
CGCCTCGATAATAAATTCATAGACGAGGCTGAACCTGCGCTCGCTAAGGGCCTGCCTGTGCACATCGAATGCGAC
GTGACAAACACCGATCGCGCCCTCGGAACTTCTCTGTCTTATCGCATCTCGAAGCTTTACGGGGAGGAGGGTCTC
CCGAAGGATACCATCCATATTCGTATGAGGGGGTCTGCTGGGCAGTCATGCGGAGCCTTCCTTGCCCCAGGTATC
ACTATCGAGTTGGAGGGTGATGCTAATGATTACGTTGGAAAGGGTCTCTCTGGTGGAAGACTCGTTGTCTACCCT
CCGAAGCAGTCAACATTCAAAGCGGAAGAGAACATCATCATTGGGAATGTCTGTTTATACGGTGCCACTTCTGGT
GAAGCGTTTATTCGCGGAATTGCTGCAGAACGTTTTGCTGTCCGTAATTCGGGTGCTAACGCTGTCGTAGAGGGT
TGCGGTGATCACGGCTGTGAATATATGACTGGCGGCCGTGTCGTTGTACTTGGTTTCACTGGCCGCAACTTTGCC
GCTGGAATGAGTGGAGGTATTGCCTACGTTCTGGATATGGCCCACACTTTTGCCTCGAAGGTGAATATGGAAATG
GTCGAACTAGGCAAGGTAACGGATCCTCGTGAAATAGCTGCGCTGCGTAGCCTGATCGAAGACCATCGTCACTAT
ACCGGATCCGAAATTGCAGATCGTGTTCTTCATGACTTCCATCACATTCTTCCCCTCTTCGTTCGGGTCATGCCT
TCAGACTACAGGCGAGTGTTAGAGGAGCAAGCAGTACGTGAAAAGGAGGAGAAACAGCGTCTCAGCGTTATTGAT
CTCGTCCCCTCTCGAACCGCCAGCCAGGTAGATCTGGCATCTGAAGCTCTCGAGGATATCTTATTACACAAAACG
CAATCCTCCACTTCCATATCTAAACCGCGTCATGAACCGTCTGTGACTGATCTCGAAGACTCCCTCGTTGATGAA
TCGACAAACAAGAAGCGTCTCGACAAACTCGATAAATTGCGTGGCTTCATGAAATACAAGCGTCTTGGAGAAGCT
TATCGCCCTCCTCGTAAGCGCGTCAAAGATTGGAAGGAAATTTCCGGACGCCTAACTGAGAGCGAGCTTAAATAC
CAATCTGCACGCTGCATGGATTGTGGTGTTCCGTTCTGTCAGTCAGATACTGGTTGTCCCATTTCCAACATTATT
CCCAAGTGGAATGACCTAGTGTTCAAGGGACAATGGCAAGATGCCCTTAATCGTCTCCTGATGACCAACAACTTC
CCTGAGTTCACTGGTCGTGTTTGTCCAGCTCCTTGCGAAGGTGCTTGTGTTCTGGGAATCAATGAGCATCCCGTA
GGCATCAAGAGCATCGAATGTGCGATAATTGACAAGGGATTCGAGATGGGTTGGATGACACCTCGTCTACCGGCT
TCCAGGAGTGGAAAGAGCGTCGCTATCATTGGATCTGGCCCCTCGGGTCTTGCTTGCGCTGATCAGCTGAATAAA
GCAGGGCATTGGGTTACAGTGTACGATCGCAACGATCGCATGGGAGGCCTTCTCATGTACGGAATTCCTAACATG
AAGCTGGACAAAAATATCGTACAAAGACGTATTGACCTTATGGCTGCCGAGGGCATTACTTTCATCCCTAACGCT
CACGTCGGTGTCGATGTCGATGTGAACGAATTGCGTGATCAACATGACGCGGTTGTCGTTTGTACTGGTGCCACT
TGGCCTCGCGACCTCAAATTACCAAATCGAAGTGCCAATGGTATTCATTTCGCTATGGAGTATCTCCAGTTGAAT
ACAAAGTCGTTGTTGGATTCGGAACTCCAGGATAATTCGTACATCAGCGCTAAAGGCAAGGAAGTTATTGTCATC
GGTGGCGGAGATACTGGTAATGATTGTATCGGTACTGCAATGCGTCATGGTGCCAAATCCGTGGTCAATTTTGAG
TTGCTTCCAAAGCCACCTGCATCGCGCGGCCGTGATAATCCTTGGCCGCAATGGCCTCGTATTTTCCGGGCTGAC
TATGGTCACATTGAAGTTGCTGCTCATTTCGGGCACGATCCCCGTGAATATTGCATATCTACCAAAGATTTTGTC
GTTGATGAGGACAACAACCTCACTGGATTAAACACTGTCCGTGTCGAGTGGACCAAAGATAGTGGTGGTCGCTGG
AAAATGGAGGAAGTCCCAGGATCGGAGAAGTTTTTCCCCGCCCAGCTTGTCTTCCTTGCCCTCGGTTTTATGGGT
CCCGAAGCCAATGTTGTCAAAGATCTCGGCCTCAAGCAAGATGCTCGTTCTAACATCCAAACTCCTCCCAAGAAA
TATTGCACAAACGTCGAGGGCGTATTTGCTGCTGGTGATTGCAGACGCGGTCAATCCCTGATTGTTTGGGGCATT
AACGAGGGGCGCGAAGCTGCTGCCGAAGTTGACGCTCATCTGAGTGGTTCAACCAGGCTACCGCGTGCAGGAGGT
ATTAAGACCAGGACTTTTGTTCCGCCTCCAAGCAAAGTGGTCCAGAACGGCCATCCAATCGAGGTGCAGGCTTAA
Gene >AgabiH97|058680
ATGACTATTCACAATTCCCAACATCTTGCTACATCTACTTCTGATTTACCCCTTGTATCTGAGACCGCCACTTTA
GAAAACATTGACGGATTTCACGCAGTAAAACGCGACGAAAACTCTTGGGCTGCTACACTCCCAGCCGATCAGGGC
CTCTACAGTAATGTGAACGAAAAAGACTCGTGTGGTGTTGGCTTTATCTGCCACATCAAAGGTGAACGCAGCCAC
AAGATAGTGTCTGATGCTCGTCAGCTATTATGTGCCATGACTCACAGAGGTGCAACTGGAGCTGATAGCCGTGAT
GGCGATGGTGCGGGTGTGATGACCGGCATTCCTCACGAGTTTTTCAAACGAGAGGCGGAAATGGACATCGGTTGC
GCTCTCCCAGAGCTTGGGGAATATGCTGTTGGGAACATTTTCTTCAAGAAGGATGACCTCGTGCAAACACCGGCG
CAACAAGCCATATTTGCCAAGATTGCCAACGACCTTGGTCTCCGTGTGCTTGGCTGGCGAGAGGTACCCACTGAC
GGTACTATTCTCGGGCCCGCCGCTAGCAGCAGAGAACCTACCATATTGCAACCTTTTGTTGTCCTCCGTAGTCAC
TATGGCGATGGAAGTTCTAGCCAATGTGGCACTTTTGATGCTCGCCACTTCGAGCGTCAATTGTATGTCCTTCGT
AAGCATGCTACCCATCGTATGTTCGTATATCCTTTTTTGCTGCTCTTCTGATGTTACAAACTGAACTCGTCCCAT
TCGATTAGTGGTCTCTCCAAAGGATTTTACTTATGTTCTTTGGCATCGAAGAACATCGTCTACAAAGGCCAACTT
TCCCCATCTCAAGTATACAACTACTACCATGATTTGAACCATGTTTTGTACCGATCACACTTCACACTGGTACAT
TCCCGTTTCTCCACCAATACGTTCCCGAGTTGGGACCGTGCCCAACCTTTGAGATGGGCTGCTCACAATGGCAAG
TATAAAATGACGTCAGTATATCACTTTGTCTAATTGCTTTTCCTTTTTCAGGTGAGATAAACACCGTGCGAGGAA
ACAAGAATTGGATGCGTGCGCGTGAAGGTGTATTATCGTCACAACACTTTGGTGACCAATTGGATCTTCTTTATC
CCATTATCGAAACGGGTGGCTCCGATTCCGCCGCCTTCGACAACGTCTTAGAACTTTTGGTCGTTAATGGTGTCG
TAACGTTACCTGAGGCTGTCATGATGATGATACCCGAAGCTTGGCAGGGCAATGAACATATGGAGCCGGAGAAAA
AGGCATTTTACAGCTGGGCGGCCTGTCTCCAGGAGCCATGGGATGGTCCTGCGCTTTTCACCTTCAGTGACGGTC
GTTATTGTGGTGCCAACCTTGATCGAAATGGTCTTCGTCCGTGTCGATTCATAATCTCCAACGAAGACATCATGG
TCTGTGCTTCTGAAGTTGGGGTCATTCCCATTGCGCCCGAAAAAGTGGTGCAAAAAGGTCGCCTGAAGCCTGGTC
GTATGTTATTAGTTGACACTTTAGAGGGACGTGTTGTCGACGACAAGGAGCTCAAGCACAATACCGCATCAAAGA
AGGATTTTGCTTCCTGGCTCGAGTCGAACGTTTTGCAGGTGCCGAAGATTATAAAACGCGTTAAGCGCAGCCACA
TACAACTGGAACCCACTCTTGATGATTCTACTCTAAGCACTGATCCAAAATTGCTTGCATTCGGTTACACCTCGG
AGCAGCTTAACCTTCTCATGCTTCCTATGATCATCGGTGGGAAGGAAGCTCTTGGATCAATGGGCAATGACGCTC
CGCTGGCATGCATGGCAACACAACCCCGTCTCATTTTCGATTACTTCCGCCAGTTATTTGCGCAGGTCACGAATC
CGCCTATTGATTCCATCCGGGAGAGTATTGTGATGTCTTTAGAAGCATACGTTGGACCTGAAGGTAATCTGCTTG
ATATGAAGCCCGAGCAGTGCCATCGTATTCTCCTCCCCTCTCCTATCATCTCCATCGAAGAAATGAATGCTATGA
AGAACTTGAAGTCTGCTTATGTTACCTGGCCTTCTCGTACCATTGACATAACATTCCCCAAGGGCGAAGGACTTC
CTGGCTATAAGGCAGCCTTGGAGCGCGTCTGTAGTGAGGCAACGCAGGCAATTGAAGATGGGGTCAAAGTCGTCG
TTTTGAGTGACCGCGCCATTGGTCCTGACCGTGTTCCTCTTTCTGCATTGATCGCCTGCGGTGGTGTTCATCATT
ATTTGACGTCCCAAAAAAAGCGCGCCAAGGTTGCTCTCATGGTCGAAACTGCCGAAGCTCGCGAAGTTCATCACC
TCTGCGTCCTGGTTGGTTATGGGGCTGACGCTATATGCCCGTGGTTAGCAATAGAGTCGATTCACAAAGTTGTTC
GCGAGGGACTGTGAGCAGCATTTTTCTTCCCTTCGAGTTTCTTGCTGATGAGTAGAATATAGCGTAAAATCTGAG
CTTGCTGTTGAGACACTCTTCGAAAATTATCGCCACTCGGTCGACAATGGTATTCTGAAAGTCATGTCAAAAATG
GGGATCTCTACCCTCCAATCATACAAGGGTGCCCAAATATTCGAGATCTTAGGGTTGCACAGTGAGGTCGTCGAC
AAGTGTTTCATTGGTTCTGCTAGTCGAATCCAGGGCGCTACATTTGACTTGCTCGCGTTGGATGCGTTTGAGCTT
CATGAACGTGGATGGCCCAGCAGGGAAACCATACTCCCCCCTGGTATGCCGGAATCTGGTGAATACCATTGGCGC
GATGGTGGAGAGGCTCACATCAACGATCCATCTGGCATCGCCAGTCTTCAGGATGCTGTCCGTGAAAAAAACCAG
GATGCCTATGATTCATATGCTCGCAATGCCAATGAACAGGCGAGCAGAGTCCATCTTCGTGGTATGCTTGATTTC
CGTTACGAAAATACCGTCGCTATCCCTATCGAACAAGTCGAGCCCTGGAACGAGATTGTTCGTCGCTTTGTCACT
GGCGCCATGTCTTATGGGTCTATCTCGATGGAGGCACATACTACCCTTGCCATTGCCATGAACCGATTAAGTGGT
AAATCTAACACTGGTGAGGGAGGCGAAGATGCCGAGCGTTCTAAAGTCTCCACCAACGGTGATACAATGCGCTCT
GCCATCAAGCAGATCGCATCTGGTCGTTTCGGTGTCACGGCCAATTATTTGGCTGATGCTGATGAGCTTCAAATA
AAGATGGCCCAAGGGGCAAAACCTGGAGAAGGTGGCGAGCTTCCTGGTCATAAAGTTTCCACCTCTATAGCTCGC
ACCCGGCATTCTACAGCCGGTGTGGGGCTGATTTCTCCCCCGCCACATCACGACATTTACTCAATCGAGGATCTA
AAACAGCTCATCTATGATCTCAAGTGTTCCAATCCACGTTCTCGTATCTCTGTTAAACTTGTTTCAGAGGTTGGA
GTCGGTATTGTTGCTAGCGGTGTTGCTAAGGCTAAGGCTGACCATATTCTAATTTCTGCCCACGATGGTGGAACT
GGCGCCTCCCGATGGACGGGCATCAAATATGCCGGTCTTCCCTGGGAGCTTGGTCTGGCCGAGACCCATCAGACT
CTTGTTCTCAATGACTTACGTGGTCGTGTAACTGTTCAAACAGACGGTCAGATTCGAACGGGCAGGGACATTGCA
ATCGCCTGTCTGCTAGGTGCTGAGGAGTGGGGTTTCGCTACTACACCACTAATTGCCATGGGTTGTATCATGATG
AGAAAATGTCATCGTACGTGACATACTTGCTGAACTAAATTTGTGGTCTAACACCATTTCCAGTCAATACGTGCC
CCGTAGGTATTGCTACACAAGATCCCCAACTTCGAGCGAAGTTTGCCGGCCAACCCGAGCAGGTTATCAACTTTT
TCTACTATCTTGCCGAAGAACTTCGTGGCATAATGGCCAAGCTTGGTTTCCGCACTATCAATGAAATGGTCGGCA
GAGCTGACATGCTCAAGGTCAATGAAAAGCTACGCACACCTAAGACTGCGTACCTTGATCTCTCGGCTATCCTCA
AGCCAGCATGGCAGATGCGCCCTGGTGCTGCCACTCATCGCGTCCGTCAACAAGATCATAAGCTTTACATCCGCC
TCGATAATAAATTCATAGACGAGGCTGAACCTGCGCTCGCTAAGGGCCTGCCTGTGCACATCGAATGCGACGTGA
CAAACACCGATCGCGCCCTCGGAACTTCTCTGTCTTATCGCATCTCGAAGCTTTACGGGGAGGAGGGTCTCCCGA
AGGATACCATCCATATTCGTATGAGGGGGTCTGCTGGGCAGTCATGCGGAGCCTTCCTTGCCCCAGGTATCACTA
TCGAGTTGGAGGGTGATGCTAATGATTACGTTGGAAAGGGTCTCTCTGGTGGAAGACTCGTTGTCTACCCTCCGA
AGCAGTCAACATTCAAAGCGGAAGAGAACATCATCATTGGGAATGTCTGTTTATACGGTGCCACTTCTGGTGAAG
CGTTTATTCGCGGAATTGCTGCAGAACGTTTTGCTGTCCGTAATTCGGGTGCTAACGCTGTCGTAGAGGGTTGCG
GTGATCACGGCTGTGAATATATGACTGGCGGCCGTGTCGTTGTACTTGGTTTCACTGGCCGCAACTTTGCCGCTG
GAATGAGTGGAGGTATTGCCTACGTTCTGGATATGGCCCACACTTTTGCCTCGAAGGTGAATATGGAAATGGTCG
AACTAGGCAAGGTAACGGATCCTCGTGAAATAGCTGCGCTGCGTAGCCTGATCGAAGACCATCGTCACTATACCG
GATCCGAAATTGCAGATCGTGTTCTTCATGACTTCCATCACATTCTTCCCCTCTTCGTTCGGGTCATGCCTTCAG
ACTACAGGCGAGTGTTAGAGGAGCAAGCAGTACGTGAAAAGGAGGAGAAACAGCGTCTCAGCGTTATTGATCTCG
TCCCCTCTCGAACCGCCAGCCAGGTAGATCTGGCATCTGAAGCTCTCGAGGATATCTTATTACACAAAACGCAAT
CCTCCACTTCCATATCTAAACCGCGTCATGAACCGTCTGTGACTGATCTCGAAGACTCCCTCGTTGATGAATCGA
CAAACAAGAAGCGTCTCGACAAACTCGATAAATTGCGTGGCTTCATGAAATACAAGCGTCTTGGAGAAGCTTATC
GCCCTCCTCGTAAGCGCGTCAAAGATTGGAAGGAAATTTCCGGACGCCTAACTGAGAGCGAGCTTAAATACCAAT
CTGCACGCTGCATGGATTGTGGTGTTCCGTTCTGTCAGTCAGATACTGGTTGTCCCATTTCCAACATTATTCCCA
AGTGGAATGACCTAGTGTTCAAGGGACAATGGCAAGATGCCCTTAATCGTCTCCTGATGACCAACAACTTCCCTG
AGTTCACTGGTCGTGTTTGTCCAGCTCCTTGCGAAGGTGCTTGTGTTCTGGGAATCAATGAGCATCCCGTAGGCA
TCAAGAGCATCGAATGTGCGATAATTGACAAGGTAAAAGTTATACTATCCTATTGATTGTTCGAGGCTGTAACGT
GTTACCTATGTGCACAGGGATTCGAGATGGGTTGGATGACACCTCGTCTACCGGCTTCCAGGAGTGGAAAGAGCG
TCGCTATCATTGGATCTGGCCCCTCGGGTCTTGCTTGCGCTGATCAGCTGAATAAAGCAGGGCATTGGGTTACAG
TGTACGATCGCAACGATCGCATGGGAGGCCTTCTCATGTACGGAATTCCTAAGTAAGTCTACCATCTGATCGCCA
ATTATGCAATGTTTAAATGTGCTTTCCTAGCATGAAGCTGGACAAAAATATCGTACAAAGACGTATTGACCTTAT
GGCTGCCGAGGGCATTGTCTGCATAGCTTCTTATCTGGTCTACATCACGCTAACGTTTTCTTCAGACTTTCATCC
CTAACGCTCACGTCGGTGTCGATGTCGATGTGAACGAATTGCGTGATCAACATGACGCGGTTGTCGTTTGTACTG
GTGCCACTTGGCCTCGCGACCTCAAATTACCAAATCGAAGTGCCAATGGTATTCATTTCGCTATGGAGTATCTCC
AGGTATGAAAAGTCATTTCAATACATGATCCCCGCCTCAATCTTTCATGTAGTTGAATACAAAGTCGTTGTTGGA
TTCGGAACTCCAGGATAATTCGTACATCAGCGCTAAAGGCAAGGAAGTTATTGTCATCGGTGGCGGAGATACTGG
TAATGATTGTATCGGTACTGCAATGCGTCATGGTGCCAAATCCGTGGTCAATTTTGAGTTGCTTCCAAAGCCACC
TGCATCGCGCGGCCGTGATAATCCTTGGCCGCAATGGCCTCGGTAAGATAAAGTGCCCATGGTATCTGCTGATTT
CTACTAATATCTGCGTTCAGTATTTTCCGGGCTGACTATGGTCACATTGAAGTTGCTGCTCATTTCGGGCACGGT
TAGTATTTCTAAACTTTGTATCATCGGCACCTTCTTAATTCATAAGCTAGATCCCCGTGAATATTGCATATCTAC
CAAAGATTTTGTCGTTGATGAGGACAACAACCTCACTGGATTAAACACTGGTATGTAATTAAACAGCGTCTTTCC
TGTTTCAAGTAAAATAAATGACAAATCCACCCAGTCCGTGTCGAGTGGACCAAAGATAGTGGTGGTCGCTGGAAA
ATGGAGGAAGTCCCAGGATCGGAGAAGTTTTTCCCCGCCCAGCTTGTCTTCCTTGCCCTCGGTTTTATGGGTCCC
GAAGCCAATGTTGTCAAAGATCTCGGCCTCAAGCAAGATGCTCGTTCTAACATCCAAACTCCTCCCAAGGTACGT
ACATGTCATTGGCTTGTGCTGATTATTCATTCAATTGTATATTAGAAATATTGCACAAACGTCGAGGGCGTATTT
GCTGCTGGTGATTGCAGACGCGGTCAATCCCTGATTGTTTGGGGCATTAAGTCAGTCTTTCGGTCTTCTCATTTA
CGAACACTGTTCATTTCGATTTCTAGCGAGGGGCGCGAAGCTGCTGCCGAAGTTGACGCTCATCTGAGTGGTTCA
ACCAGGCTACCGCGTGCAGGAGGTATTAAGACCAGGGTCAGTAGATCTGATTTCCTCTATCTGCAAAGCACAAAC
TCAGGGTTTTGTAGACTTTTGTTCCGCCTCCAAGCAAAGTGGTCCAGAACGGCCATCCAATCGAGGTGCAGGCTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail