© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|058620 |
| Gene name | |
| Location | scaffold_3:1441815..1444903 |
| Strand | + |
| Gene length (bp) | 3088 |
| Transcript length (bp) | 2559 |
| Coding sequence length (bp) | 2559 |
| Protein length (aa) | 853 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 2.8E-31 | 329 | 492 |
| PF11987 | IF-2 | Translation-initiation factor 2 | 1.8E-30 | 621 | 737 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 7.0E-08 | 330 | 432 |
| PF04760 | IF2_N | Translation initiation factor IF-2, N-terminal region | 9.1E-06 | 247 | 299 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q89WA9|IF2_BRADU | Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 | 195 | 848 | 4.0E-138 |
| sp|B1ZDQ8|IF2_METPB | Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 | 237 | 847 | 5.0E-137 |
| sp|Q6NCN5|IF2_RHOPA | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 | 186 | 848 | 3.0E-136 |
| sp|Q2J2J9|IF2_RHOP2 | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 | 186 | 848 | 1.0E-135 |
| sp|Q21C31|IF2_RHOPB | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 | 195 | 848 | 1.0E-135 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q89WA9|IF2_BRADU | Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 | 195 | 848 | 4.0E-138 |
| sp|B1ZDQ8|IF2_METPB | Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 | 237 | 847 | 5.0E-137 |
| sp|Q6NCN5|IF2_RHOPA | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 | 186 | 848 | 3.0E-136 |
| sp|Q2J2J9|IF2_RHOP2 | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 | 186 | 848 | 1.0E-135 |
| sp|Q21C31|IF2_RHOPB | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 | 195 | 848 | 1.0E-135 |
| sp|A4YJE9|IF2_BRASO | Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 | 195 | 848 | 3.0E-135 |
| sp|Q13EL8|IF2_RHOPS | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB5) GN=infB PE=3 SV=1 | 186 | 848 | 5.0E-134 |
| sp|A5E866|IF2_BRASB | Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 | 195 | 848 | 6.0E-134 |
| sp|Q07V78|IF2_RHOP5 | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisA53) GN=infB PE=3 SV=1 | 195 | 848 | 9.0E-134 |
| sp|O59683|IF2M_SCHPO | Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 | 246 | 849 | 9.0E-133 |
| sp|B8GP02|IF2_THISH | Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-132 |
| sp|Q5QTY8|IF2_IDILO | Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 | 214 | 847 | 2.0E-131 |
| sp|A5FV21|IF2_ACICJ | Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 | 243 | 845 | 3.0E-131 |
| sp|B3R1E4|IF2_CUPTR | Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-130 |
| sp|Q0K9B9|IF2_CUPNH | Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-130 |
| sp|A8IG20|IF2_AZOC5 | Translation initiation factor IF-2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=infB PE=3 SV=1 | 194 | 844 | 4.0E-130 |
| sp|A1RGX5|IF2_SHESW | Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 | 172 | 847 | 7.0E-130 |
| sp|A4Y9C0|IF2_SHEPC | Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 | 172 | 847 | 7.0E-130 |
| sp|A9KZX1|IF2_SHEB9 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 | 172 | 847 | 2.0E-129 |
| sp|A6WRG8|IF2_SHEB8 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 | 172 | 847 | 2.0E-129 |
| sp|A3D7K6|IF2_SHEB5 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 | 172 | 847 | 2.0E-129 |
| sp|B8E6N2|IF2_SHEB2 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 | 172 | 847 | 2.0E-129 |
| sp|Q0HXR5|IF2_SHESR | Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 | 208 | 847 | 4.0E-129 |
| sp|Q0HLG1|IF2_SHESM | Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 | 208 | 847 | 4.0E-129 |
| sp|Q3SWP9|IF2_NITWN | Translation initiation factor IF-2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=infB PE=3 SV=1 | 195 | 848 | 4.0E-129 |
| sp|Q1QS64|IF2_NITHX | Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 | 195 | 848 | 4.0E-129 |
| sp|Q8EHL5|IF2_SHEON | Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 | 172 | 847 | 5.0E-129 |
| sp|A0KTZ6|IF2_SHESA | Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 | 172 | 847 | 6.0E-129 |
| sp|Q1LLR6|IF2_CUPMC | Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-129 |
| sp|Q12QI1|IF2_SHEDO | Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 | 208 | 847 | 2.0E-128 |
| sp|B8EIA7|IF2_METSB | Translation initiation factor IF-2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=infB PE=3 SV=1 | 195 | 847 | 3.0E-128 |
| sp|Q086H2|IF2_SHEFN | Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 | 176 | 847 | 3.0E-128 |
| sp|A3QGU5|IF2_SHELP | Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 | 181 | 847 | 9.0E-128 |
| sp|A7HZ93|IF2_PARL1 | Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 | 243 | 843 | 3.0E-127 |
| sp|A8FYS0|IF2_SHESH | Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 | 238 | 847 | 4.0E-127 |
| sp|B2JKT4|IF2_BURP8 | Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-127 |
| sp|Q140U6|IF2_BURXL | Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 | 178 | 847 | 3.0E-126 |
| sp|Q11BC8|IF2_CHESB | Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 | 243 | 844 | 4.0E-126 |
| sp|A1UU50|IF2_BARBK | Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 | 243 | 844 | 7.0E-126 |
| sp|B1XV89|IF2_POLNS | Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-126 |
| sp|B1KRR0|IF2_SHEWM | Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 | 241 | 847 | 8.0E-126 |
| sp|Q0A797|IF2_ALKEH | Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-125 |
| sp|A6WWW5|IF2_OCHA4 | Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 | 243 | 844 | 1.0E-125 |
| sp|B0TQA2|IF2_SHEHH | Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 | 241 | 847 | 2.0E-125 |
| sp|B2T381|IF2_BURPP | Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 | 178 | 847 | 3.0E-125 |
| sp|A9IMT5|IF2_BART1 | Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 | 243 | 844 | 3.0E-125 |
| sp|A1S462|IF2_SHEAM | Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-125 |
| sp|Q0AK69|IF2_MARMM | Translation initiation factor IF-2 OS=Maricaulis maris (strain MCS10) GN=infB PE=3 SV=1 | 192 | 847 | 5.0E-125 |
| sp|A1V3N4|IF2_BURMS | Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-125 |
| sp|Q62KK9|IF2_BURMA | Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-125 |
| sp|A2S2L1|IF2_BURM9 | Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-125 |
| sp|A3MJW4|IF2_BURM7 | Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-125 |
| sp|Q16D38|IF2_ROSDO | Translation initiation factor IF-2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=infB PE=3 SV=1 | 243 | 844 | 7.0E-125 |
| sp|B3PI96|IF2_CELJU | Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 | 243 | 847 | 8.0E-125 |
| sp|A4SY78|IF2_POLSQ | Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-125 |
| sp|Q8FXT2|IF2_BRUSU | Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 | 243 | 844 | 1.0E-124 |
| sp|Q9KA77|IF2_BACHD | Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 | 227 | 843 | 1.0E-124 |
| sp|B0CK11|IF2_BRUSI | Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 | 206 | 844 | 2.0E-124 |
| sp|Q57AA0|IF2_BRUAB | Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 | 206 | 844 | 2.0E-124 |
| sp|Q2YQR7|IF2_BRUA2 | Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 | 206 | 844 | 2.0E-124 |
| sp|Q8YEB3|IF2_BRUME | Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 | 243 | 844 | 2.0E-124 |
| sp|B8CKH3|IF2_SHEPW | Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 | 241 | 847 | 2.0E-124 |
| sp|A8H740|IF2_SHEPA | Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 | 241 | 847 | 2.0E-124 |
| sp|A9M9Z4|IF2_BRUC2 | Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 | 243 | 844 | 3.0E-124 |
| sp|Q63TP8|IF2_BURPS | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-124 |
| sp|A3N8V8|IF2_BURP6 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-124 |
| sp|Q3JSY9|IF2_BURP1 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-124 |
| sp|Q6G0P2|IF2_BARQU | Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 | 163 | 844 | 4.0E-124 |
| sp|B2FN90|IF2_STRMK | Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 | 183 | 852 | 5.0E-124 |
| sp|A3NUL0|IF2_BURP0 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-124 |
| sp|B2UAA3|IF2_RALPJ | Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-124 |
| sp|Q2SVG8|IF2_BURTA | Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-124 |
| sp|Q39H30|IF2_BURL3 | Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 | 186 | 847 | 1.0E-123 |
| sp|C5CLW3|IF2_VARPS | Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 | 242 | 847 | 1.0E-123 |
| sp|B0TWR3|IF2_FRAP2 | Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 | 244 | 847 | 1.0E-123 |
| sp|Q46ZP1|IF2_CUPPJ | Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-123 |
| sp|A5VTB2|IF2_BRUO2 | Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 | 206 | 844 | 2.0E-123 |
| sp|A4SJR5|IF2_AERS4 | Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-123 |
| sp|Q5FQM3|IF2_GLUOX | Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-123 |
| sp|A0KNE3|IF2_AERHH | Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-123 |
| sp|A4XL70|IF2_CALS8 | Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 | 244 | 844 | 3.0E-123 |
| sp|A7H9F3|IF2_ANADF | Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 | 237 | 847 | 4.0E-123 |
| sp|A4JDX1|IF2_BURVG | Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-123 |
| sp|A0K6X5|IF2_BURCH | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 | 212 | 847 | 6.0E-123 |
| sp|Q1BWS7|IF2_BURCA | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 | 212 | 847 | 6.0E-123 |
| sp|B4E7L1|IF2_BURCJ | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-123 |
| sp|Q2RMS0|IF2_RHORT | Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 | 195 | 852 | 7.0E-123 |
| sp|A8LQ56|IF2_DINSH | Translation initiation factor IF-2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=infB PE=3 SV=1 | 243 | 844 | 7.0E-123 |
| sp|B1K0M0|IF2_BURCC | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 | 212 | 847 | 8.0E-123 |
| sp|A0Q8F3|IF2_FRATN | Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 | 244 | 847 | 8.0E-123 |
| sp|Q6G4W7|IF2_BARHE | Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 | 237 | 844 | 1.0E-122 |
| sp|Q0BFY3|IF2_BURCM | Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-122 |
| sp|Q0AFJ3|IF2_NITEC | Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 | 208 | 852 | 1.0E-122 |
| sp|C3K259|IF2_PSEFS | Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain SBW25) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-122 |
| sp|B8JFY6|IF2_ANAD2 | Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 | 237 | 847 | 2.0E-122 |
| sp|Q1GCH2|IF2_RUEST | Translation initiation factor IF-2 OS=Ruegeria sp. (strain TM1040) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-122 |
| sp|Q2A1G8|IF2_FRATH | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 | 244 | 847 | 2.0E-122 |
| sp|B4UHG0|IF2_ANASK | Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 | 237 | 844 | 2.0E-122 |
| sp|A4WW80|IF2_RHOS5 | Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-122 |
| sp|Q5LWL4|IF2_RUEPO | Translation initiation factor IF-2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-122 |
| sp|A9ABD5|IF2_BURM1 | Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-122 |
| sp|Q0BK70|IF2_FRATO | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 | 244 | 847 | 2.0E-122 |
| sp|A7NEI8|IF2_FRATF | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 | 244 | 847 | 2.0E-122 |
| sp|C5D9C9|IF2_GEOSW | Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 | 244 | 848 | 2.0E-122 |
| sp|A1WXV1|IF2_HALHL | Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-122 |
| sp|A6T0Y8|IF2_JANMA | Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-122 |
| sp|A1U600|IF2_MARHV | Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 | 210 | 846 | 2.0E-122 |
| sp|Q0BPG2|IF2_GRABC | Translation initiation factor IF-2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=infB PE=3 SV=1 | 232 | 845 | 2.0E-122 |
| sp|Q5NIL7|IF2_FRATT | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 | 244 | 847 | 3.0E-122 |
| sp|Q14K20|IF2_FRAT1 | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 | 244 | 847 | 3.0E-122 |
| sp|Q5GXU9|IF2_XANOR | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 | 184 | 847 | 3.0E-122 |
| sp|Q2P0X1|IF2_XANOM | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 | 184 | 847 | 3.0E-122 |
| sp|B2SVK3|IF2_XANOP | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 | 184 | 847 | 3.0E-122 |
| sp|B1YP36|IF2_BURA4 | Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-122 |
| sp|A8GW31|IF2_RICB8 | Translation initiation factor IF-2 OS=Rickettsia bellii (strain OSU 85-389) GN=infB PE=3 SV=1 | 206 | 848 | 4.0E-122 |
| sp|B2SEW7|IF2_FRATM | Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 | 244 | 847 | 5.0E-122 |
| sp|Q3AB98|IF2_CARHZ | Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 | 238 | 848 | 6.0E-122 |
| sp|Q2KXY7|IF2_BORA1 | Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-122 |
| sp|B9JYK6|IF2_AGRVS | Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 | 224 | 844 | 7.0E-122 |
| sp|Q28WF7|IF2_JANSC | Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 | 181 | 847 | 8.0E-122 |
| sp|A9ITX6|IF2_BORPD | Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-122 |
| sp|Q5NZS1|IF2_AROAE | Translation initiation factor IF-2 OS=Aromatoleum aromaticum (strain EbN1) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-121 |
| sp|Q1RIX0|IF2_RICBR | Translation initiation factor IF-2 OS=Rickettsia bellii (strain RML369-C) GN=infB PE=3 SV=1 | 206 | 848 | 1.0E-121 |
| sp|Q3SKX1|IF2_THIDA | Translation initiation factor IF-2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-121 |
| sp|Q6FF40|IF2_ACIAD | Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 | 243 | 843 | 2.0E-121 |
| sp|A3PNL2|IF2_RHOS1 | Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-121 |
| sp|Q3IYN5|IF2_RHOS4 | Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-121 |
| sp|B0VLU2|IF2_ACIBS | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 | 224 | 843 | 2.0E-121 |
| sp|A4IMD7|IF2_GEOTN | Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 | 244 | 843 | 3.0E-121 |
| sp|Q3BRP5|IF2_XANC5 | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 | 184 | 847 | 3.0E-121 |
| sp|B0VE81|IF2_ACIBY | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 | 224 | 843 | 3.0E-121 |
| sp|B2I2M7|IF2_ACIBC | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 | 224 | 843 | 3.0E-121 |
| sp|B7I3R9|IF2_ACIB5 | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 | 224 | 843 | 3.0E-121 |
| sp|B7H115|IF2_ACIB3 | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 | 224 | 843 | 3.0E-121 |
| sp|Q7MI09|IF2_VIBVY | Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-121 |
| sp|Q8P7U7|IF2_XANCP | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 | 184 | 847 | 4.0E-121 |
| sp|Q8PJ55|IF2_XANAC | Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 | 184 | 847 | 4.0E-121 |
| sp|B0RRB4|IF2_XANCB | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 | 184 | 847 | 4.0E-121 |
| sp|Q4UWA2|IF2_XANC8 | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 | 184 | 847 | 4.0E-121 |
| sp|Q8XZV6|IF2_RALSO | Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-121 |
| sp|A8G907|IF2_SERP5 | Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-121 |
| sp|Q6D9A5|IF2_PECAS | Translation initiation factor IF-2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-121 |
| sp|B3EAE7|IF2_GEOLS | Translation initiation factor IF-2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=infB PE=3 SV=1 | 212 | 844 | 6.0E-121 |
| sp|A4G7S7|IF2_HERAR | Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-121 |
| sp|A1JIW9|IF2_YERE8 | Translation initiation factor IF-2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=infB PE=3 SV=1 | 58 | 847 | 8.0E-121 |
| sp|P04766|IF2_GEOSE | Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 | 244 | 843 | 8.0E-121 |
| sp|Q8UJ51|IF2_AGRFC | Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 | 243 | 844 | 8.0E-121 |
| sp|C5BFB7|IF2_EDWI9 | Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-120 |
| sp|A4IW10|IF2_FRATW | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 | 244 | 844 | 1.0E-120 |
| sp|Q8DBW0|IF2_VIBVU | Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-120 |
| sp|Q7MYY7|IF2_PHOLL | Translation initiation factor IF-2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=infB PE=3 SV=1 | 58 | 847 | 1.0E-120 |
| sp|B1J2A9|IF2_PSEPW | Translation initiation factor IF-2 OS=Pseudomonas putida (strain W619) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-120 |
| sp|Q1MN39|IF2_RHIL3 | Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 | 243 | 844 | 1.0E-120 |
| sp|Q9ZF28|IF2_KLEOX | Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-120 |
| sp|Q92SW4|IF2_RHIME | Translation initiation factor IF-2 OS=Rhizobium meliloti (strain 1021) GN=infB PE=3 SV=1 | 243 | 844 | 1.0E-120 |
| sp|Q7W9A5|IF2_BORPA | Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|C6DKK3|IF2_PECCP | Translation initiation factor IF-2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|B2IIJ7|IF2_BEII9 | Translation initiation factor IF-2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=infB PE=3 SV=1 | 236 | 847 | 2.0E-120 |
| sp|Q7WHG2|IF2_BORBR | Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|Q4KIF6|IF2_PSEF5 | Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|B4SQS0|IF2_STRM5 | Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 | 205 | 852 | 2.0E-120 |
| sp|Q482T9|IF2_COLP3 | Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 | 178 | 847 | 2.0E-120 |
| sp|Q88DV7|IF2_PSEPK | Translation initiation factor IF-2 OS=Pseudomonas putida (strain KT2440) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|A5W987|IF2_PSEP1 | Translation initiation factor IF-2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-120 |
| sp|Q7VLI2|IF2_HAEDU | Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 | 53 | 847 | 2.0E-120 |
| sp|Q2Y7W2|IF2_NITMU | Translation initiation factor IF-2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=infB PE=3 SV=1 | 243 | 844 | 3.0E-120 |
| sp|Q98BI8|IF2_RHILO | Translation initiation factor IF-2 OS=Rhizobium loti (strain MAFF303099) GN=infB PE=3 SV=1 | 212 | 844 | 3.0E-120 |
| sp|C1D8X2|IF2_LARHH | Translation initiation factor IF-2 OS=Laribacter hongkongensis (strain HLHK9) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-120 |
| sp|B0KHX8|IF2_PSEPG | Translation initiation factor IF-2 OS=Pseudomonas putida (strain GB-1) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-120 |
| sp|B0UU13|IF2_HISS2 | Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 | 241 | 847 | 4.0E-120 |
| sp|A5CXX6|IF2_VESOH | Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 | 243 | 852 | 4.0E-120 |
| sp|Q0I3P5|IF2_HAES1 | Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 | 241 | 847 | 4.0E-120 |
| sp|P57873|IF2_PASMU | Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 | 134 | 847 | 4.0E-120 |
| sp|B0K1D6|IF2_THEPX | Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 | 246 | 849 | 5.0E-120 |
| sp|Q24UI6|IF2_DESHY | Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 | 227 | 843 | 6.0E-120 |
| sp|Q2KDZ5|IF2_RHIEC | Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 | 243 | 844 | 6.0E-120 |
| sp|Q5ZRV4|IF2_LEGPH | Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-120 |
| sp|A5IHU7|IF2_LEGPC | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-120 |
| sp|Q1GXD6|IF2_METFK | Translation initiation factor IF-2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=infB PE=3 SV=1 | 209 | 847 | 7.0E-120 |
| sp|Q5X1C3|IF2_LEGPA | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-120 |
| sp|Q2RJM5|IF2_MOOTA | Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 | 176 | 848 | 7.0E-120 |
| sp|Q0VSS1|IF2_ALCBS | Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 | 239 | 847 | 8.0E-120 |
| sp|Q7VYR2|IF2_BORPE | Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 | 243 | 847 | 8.0E-120 |
| sp|P46198|IF2M_BOVIN | Translation initiation factor IF-2, mitochondrial OS=Bos taurus GN=MTIF2 PE=1 SV=1 | 225 | 850 | 9.0E-120 |
| sp|A6UF29|IF2_SINMW | Translation initiation factor IF-2 OS=Sinorhizobium medicae (strain WSM419) GN=infB PE=3 SV=1 | 227 | 844 | 9.0E-120 |
| sp|Q4ZNR2|IF2_PSEU2 | Translation initiation factor IF-2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-119 |
| sp|Q12AU7|IF2_POLSJ | Translation initiation factor IF-2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=infB PE=3 SV=1 | 212 | 847 | 1.0E-119 |
| sp|Q4FVL5|IF2_PSYA2 | Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 | 162 | 847 | 1.0E-119 |
| sp|Q47D94|IF2_DECAR | Translation initiation factor IF-2 OS=Dechloromonas aromatica (strain RCB) GN=infB PE=3 SV=1 | 57 | 847 | 1.0E-119 |
| sp|A4VPP0|IF2_PSEU5 | Translation initiation factor IF-2 OS=Pseudomonas stutzeri (strain A1501) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-119 |
| sp|P25038|IF2M_YEAST | Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 | 242 | 852 | 1.0E-119 |
| sp|Q87WQ5|IF2_PSESM | Translation initiation factor IF-2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-119 |
| sp|Q5WT36|IF2_LEGPL | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-119 |
| sp|Q1QEP5|IF2_PSYCK | Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 | 162 | 847 | 2.0E-119 |
| sp|Q9ZF25|IF2_ENTCL | Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-119 |
| sp|A1AV99|IF2_RUTMC | Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 | 243 | 848 | 3.0E-119 |
| sp|A8GSP4|IF2_RICRS | Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=infB PE=3 SV=1 | 243 | 848 | 3.0E-119 |
| sp|B0BY61|IF2_RICRO | Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Iowa) GN=infB PE=3 SV=1 | 243 | 848 | 3.0E-119 |
| sp|B7GG75|IF2_ANOFW | Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 | 244 | 843 | 4.0E-119 |
| sp|A6VNE0|IF2_ACTSZ | Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 | 114 | 847 | 4.0E-119 |
| sp|Q82WD0|IF2_NITEU | Translation initiation factor IF-2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=infB PE=3 SV=1 | 243 | 852 | 4.0E-119 |
| sp|B3PXE3|IF2_RHIE6 | Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 | 243 | 844 | 4.0E-119 |
| sp|B1HR05|IF2_LYSSC | Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 | 227 | 843 | 4.0E-119 |
| sp|Q3KI84|IF2_PSEPF | Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-119 |
| sp|B5YHT8|IF2_THEYD | Translation initiation factor IF-2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=infB PE=3 SV=1 | 244 | 843 | 6.0E-119 |
| sp|Q8RA37|IF2_CALS4 | Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 | 244 | 849 | 6.0E-119 |
| sp|A4XYE0|IF2_PSEMY | Translation initiation factor IF-2 OS=Pseudomonas mendocina (strain ymp) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-119 |
| sp|A5D2S0|IF2_PELTS | Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 | 236 | 847 | 7.0E-119 |
| sp|Q48E77|IF2_PSE14 | Translation initiation factor IF-2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-119 |
| sp|Q3IJ53|IF2_PSEHT | Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 | 238 | 847 | 7.0E-119 |
| sp|Q2NW23|IF2_SODGM | Translation initiation factor IF-2 OS=Sodalis glossinidius (strain morsitans) GN=infB PE=3 SV=1 | 243 | 847 | 8.0E-119 |
| sp|A1B587|IF2_PARDP | Translation initiation factor IF-2 OS=Paracoccus denitrificans (strain Pd 1222) GN=infB PE=3 SV=1 | 175 | 844 | 9.0E-119 |
| sp|B4F2B9|IF2_PROMH | Translation initiation factor IF-2 OS=Proteus mirabilis (strain HI4320) GN=infB PE=3 SV=1 | 183 | 847 | 1.0E-118 |
| sp|A6Q226|IF2_NITSB | Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 | 244 | 852 | 1.0E-118 |
| sp|A5EWY9|IF2_DICNV | Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-118 |
| sp|Q1IF43|IF2_PSEE4 | Translation initiation factor IF-2 OS=Pseudomonas entomophila (strain L48) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-118 |
| sp|Q01W31|IF2_SOLUE | Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 | 212 | 845 | 2.0E-118 |
| sp|A5WBS5|IF2_PSYWF | Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 | 162 | 847 | 2.0E-118 |
| sp|Q39VA6|IF2_GEOMG | Translation initiation factor IF-2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=infB PE=3 SV=1 | 227 | 848 | 2.0E-118 |
| sp|B1XY67|IF2_LEPCP | Translation initiation factor IF-2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-118 |
| sp|B0K9Q0|IF2_THEP3 | Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 | 244 | 849 | 2.0E-118 |
| sp|C1DFK9|IF2_AZOVD | Translation initiation factor IF-2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-118 |
| sp|Q0C5Z5|IF2_HYPNA | Translation initiation factor IF-2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=infB PE=3 SV=1 | 239 | 847 | 2.0E-118 |
| sp|A7Z4T4|IF2_BACMF | Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 | 229 | 848 | 3.0E-118 |
| sp|P17889|IF2_BACSU | Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 | 229 | 848 | 4.0E-118 |
| sp|Q92HF5|IF2_RICCN | Translation initiation factor IF-2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=infB PE=3 SV=1 | 243 | 848 | 4.0E-118 |
| sp|A1VNU2|IF2_POLNA | Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 | 242 | 847 | 5.0E-118 |
| sp|Q65SK9|IF2_MANSM | Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-118 |
| sp|Q4UL51|IF2_RICFE | Translation initiation factor IF-2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=infB PE=3 SV=1 | 243 | 848 | 5.0E-118 |
| sp|C3LSP8|IF2_VIBCM | Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 | 169 | 847 | 5.0E-118 |
| sp|Q9KU80|IF2_VIBCH | Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 | 169 | 847 | 5.0E-118 |
| sp|A5F926|IF2_VIBC3 | Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 | 169 | 847 | 5.0E-118 |
| sp|Q18BH4|IF2_PEPD6 | Translation initiation factor IF-2 OS=Peptoclostridium difficile (strain 630) GN=infB PE=3 SV=1 | 244 | 847 | 6.0E-118 |
| sp|B4RXT8|IF2_ALTMD | Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 | 244 | 847 | 6.0E-118 |
| sp|Q21WJ5|IF2_RHOFT | Translation initiation factor IF-2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=infB PE=3 SV=1 | 242 | 847 | 8.0E-118 |
| sp|Q8Z3H7|IF2_SALTI | Translation initiation factor IF-2 OS=Salmonella typhi GN=infB PE=3 SV=1 | 243 | 847 | 8.0E-118 |
| sp|Q3J9B6|IF2_NITOC | Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 | 243 | 848 | 9.0E-118 |
| sp|Q9HV55|IF2_PSEAE | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-118 |
| sp|A6VCK1|IF2_PSEA7 | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain PA7) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-117 |
| sp|Q02FS8|IF2_PSEAB | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-117 |
| sp|B7V1F6|IF2_PSEA8 | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain LESB58) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-117 |
| sp|C4L8X4|IF2_TOLAT | Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 | 184 | 847 | 1.0E-117 |
| sp|Q15V72|IF2_PSEA6 | Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 | 244 | 847 | 1.0E-117 |
| sp|A5VCZ5|IF2_SPHWW | Translation initiation factor IF-2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=infB PE=3 SV=1 | 243 | 848 | 2.0E-117 |
| sp|P44323|IF2_HAEIN | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-117 |
| sp|A5UBT6|IF2_HAEIE | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-117 |
| sp|B1LFS0|IF2_ECOSM | Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-117 |
| sp|Q0AYI8|IF2_SYNWW | Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 | 178 | 849 | 2.0E-117 |
| sp|Q83JF9|IF2_SHIFL | Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-117 |
| sp|Q31W47|IF2_SHIBS | Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-117 |
| sp|B7LR37|IF2_ESCF3 | Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|Q1R6H0|IF2_ECOUT | Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B6I1P3|IF2_ECOSE | Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7NDF4|IF2_ECOLU | Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|P0A705|IF2_ECOLI | Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B1IQV3|IF2_ECOLC | Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|P59587|IF2_ECOL6 | Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|Q0TCU1|IF2_ECOL5 | Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|A1AG73|IF2_ECOK1 | Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|A8A4Y4|IF2_ECOHS | Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B1XGY0|IF2_ECODH | Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|C4ZSQ9|IF2_ECOBW | Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7M076|IF2_ECO8A | Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7NKN7|IF2_ECO7I | Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B5YS58|IF2_ECO5E | Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|P0A706|IF2_ECO57 | Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7LHN3|IF2_ECO55 | Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7MB89|IF2_ECO45 | Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B7UJ63|IF2_ECO27 | Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|A7ZS65|IF2_ECO24 | Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B2U207|IF2_SHIB3 | Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|A8MFA8|IF2_ALKOO | Translation initiation factor IF-2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=infB PE=3 SV=1 | 244 | 847 | 3.0E-117 |
| sp|A8FDD1|IF2_BACP2 | Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 | 205 | 848 | 3.0E-117 |
| sp|Q5E7L5|IF2_VIBF1 | Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 | 241 | 847 | 3.0E-117 |
| sp|A9MP36|IF2_SALAR | Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|Q4QK37|IF2_HAEI8 | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 | 241 | 847 | 3.0E-117 |
| sp|B9DPF5|IF2_STACT | Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 | 234 | 847 | 3.0E-117 |
| sp|A0LV27|IF2_ACIC1 | Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 | 198 | 849 | 3.0E-117 |
| sp|Q0T0B3|IF2_SHIF8 | Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-117 |
| sp|B1JLY0|IF2_YERPY | Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|Q66F60|IF2_YERPS | Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|A4TRI3|IF2_YERPP | Translation initiation factor IF-2 OS=Yersinia pestis (strain Pestoides F) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|Q1CEL3|IF2_YERPN | Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|Q8ZBC2|IF2_YERPE | Translation initiation factor IF-2 OS=Yersinia pestis GN=infB PE=3 SV=2 | 58 | 847 | 4.0E-117 |
| sp|B2K2Q5|IF2_YERPB | Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|A7FMS2|IF2_YERP3 | Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=infB PE=3 SV=1 | 58 | 847 | 4.0E-117 |
| sp|Q3YX73|IF2_SHISS | Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-117 |
| sp|Q32BG5|IF2_SHIDS | Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-117 |
| sp|C6E2Q0|IF2_GEOSM | Translation initiation factor IF-2 OS=Geobacter sp. (strain M21) GN=infB PE=3 SV=1 | 212 | 844 | 4.0E-117 |
| sp|B7N0V3|IF2_ECO81 | Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-117 |
| sp|Q57JH9|IF2_SALCH | Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|Q732Q9|IF2_BACC1 | Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infB PE=3 SV=1 | 244 | 843 | 5.0E-117 |
| sp|A9R5A3|IF2_YERPG | Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=infB PE=3 SV=1 | 58 | 847 | 5.0E-117 |
| sp|Q9ZF31|IF2_SALTY | Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 | 243 | 847 | 5.0E-117 |
| sp|C0PZ54|IF2_SALPC | Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|A9N732|IF2_SALPB | Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B4T6Z8|IF2_SALNS | Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B4TJ06|IF2_SALHS | Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B5QZV8|IF2_SALEP | Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B5FI13|IF2_SALDC | Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B5F6T8|IF2_SALA4 | Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-117 |
| sp|B9IVA1|IF2_BACCQ | Translation initiation factor IF-2 OS=Bacillus cereus (strain Q1) GN=infB PE=3 SV=1 | 244 | 843 | 5.0E-117 |
| sp|B7HLE6|IF2_BACC7 | Translation initiation factor IF-2 OS=Bacillus cereus (strain AH187) GN=infB PE=3 SV=1 | 244 | 843 | 5.0E-117 |
| sp|B0BNR5|IF2_ACTPJ | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 | 171 | 847 | 6.0E-117 |
| sp|A2SH40|IF2_METPP | Translation initiation factor IF-2 OS=Methylibium petroleiphilum (strain PM1) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-117 |
| sp|A6TEI7|IF2_KLEP7 | Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-117 |
| sp|A8AQ58|IF2_CITK8 | Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-117 |
| sp|A8F223|IF2_RICM5 | Translation initiation factor IF-2 OS=Rickettsia massiliae (strain Mtu5) GN=infB PE=3 SV=1 | 243 | 848 | 6.0E-117 |
| sp|A7MQE1|IF2_CROS8 | Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 | 243 | 847 | 6.0E-117 |
| sp|Q74CT3|IF2_GEOSL | Translation initiation factor IF-2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=infB PE=3 SV=1 | 244 | 848 | 6.0E-117 |
| sp|B4TWD8|IF2_SALSV | Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-117 |
| sp|B5REN6|IF2_SALG2 | Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-117 |
| sp|B5XSX4|IF2_KLEP3 | Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 | 243 | 847 | 7.0E-117 |
| sp|A4WEY3|IF2_ENT38 | Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 | 243 | 847 | 8.0E-117 |
| sp|Q812X7|IF2_BACCR | Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infB PE=3 SV=1 | 244 | 843 | 8.0E-117 |
| sp|B7HDT6|IF2_BACC4 | Translation initiation factor IF-2 OS=Bacillus cereus (strain B4264) GN=infB PE=3 SV=1 | 244 | 843 | 8.0E-117 |
| sp|A1K7B9|IF2_AZOSB | Translation initiation factor IF-2 OS=Azoarcus sp. (strain BH72) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-117 |
| sp|Q10XM3|IF2_TRIEI | Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 | 239 | 848 | 9.0E-117 |
| sp|B2TJ55|IF2_CLOBB | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-116 |
| sp|Q6HF02|IF2_BACHK | Translation initiation factor IF-2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-116 |
| sp|Q636L3|IF2_BACCZ | Translation initiation factor IF-2 OS=Bacillus cereus (strain ZK / E33L) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-116 |
| sp|C1EP35|IF2_BACC3 | Translation initiation factor IF-2 OS=Bacillus cereus (strain 03BB102) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-116 |
| sp|A0RHI4|IF2_BACAH | Translation initiation factor IF-2 OS=Bacillus thuringiensis (strain Al Hakam) GN=infB PE=3 SV=2 | 244 | 843 | 1.0E-116 |
| sp|A5UF34|IF2_HAEIG | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-116 |
| sp|B3H163|IF2_ACTP7 | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 | 171 | 847 | 1.0E-116 |
| sp|A3N005|IF2_ACTP2 | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 | 171 | 847 | 1.0E-116 |
| sp|Q91YJ5|IF2M_MOUSE | Translation initiation factor IF-2, mitochondrial OS=Mus musculus GN=Mtif2 PE=1 SV=2 | 317 | 849 | 1.0E-116 |
| sp|A1AMM1|IF2_PELPD | Translation initiation factor IF-2 OS=Pelobacter propionicus (strain DSM 2379) GN=infB PE=3 SV=1 | 207 | 848 | 1.0E-116 |
| sp|Q9ZCZ8|IF2_RICPR | Translation initiation factor IF-2 OS=Rickettsia prowazekii (strain Madrid E) GN=infB PE=3 SV=1 | 243 | 848 | 2.0E-116 |
| sp|Q67P86|IF2_SYMTH | Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 | 182 | 847 | 2.0E-116 |
| sp|Q2VZV0|IF2_MAGSA | Translation initiation factor IF-2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-116 |
| sp|Q1CC07|IF2_YERPA | Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=infB PE=3 SV=1 | 58 | 847 | 2.0E-116 |
| sp|Q65JI1|IF2_BACLD | Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 | 214 | 848 | 2.0E-116 |
| sp|Q68WI4|IF2_RICTY | Translation initiation factor IF-2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=infB PE=3 SV=1 | 239 | 848 | 2.0E-116 |
| sp|B5BGJ5|IF2_SALPK | Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-116 |
| sp|Q5PLB0|IF2_SALPA | Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-116 |
| sp|Q7NY13|IF2_CHRVO | Translation initiation factor IF-2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=infB PE=3 SV=1 | 206 | 847 | 3.0E-116 |
| sp|A1ST45|IF2_PSYIN | Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-116 |
| sp|Q5NQ27|IF2_ZYMMO | Translation initiation factor IF-2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=infB PE=3 SV=1 | 243 | 852 | 4.0E-116 |
| sp|B5EI57|IF2_GEOBB | Translation initiation factor IF-2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=infB PE=3 SV=1 | 227 | 844 | 4.0E-116 |
| sp|Q835U8|IF2_ENTFA | Translation initiation factor IF-2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=infB PE=3 SV=1 | 222 | 843 | 4.0E-116 |
| sp|A7MZI5|IF2_VIBCB | Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 | 241 | 847 | 4.0E-116 |
| sp|Q81WM3|IF2_BACAN | Translation initiation factor IF-2 OS=Bacillus anthracis GN=infB PE=3 SV=1 | 244 | 843 | 4.0E-116 |
| sp|C3L7B4|IF2_BACAC | Translation initiation factor IF-2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=infB PE=3 SV=1 | 244 | 843 | 4.0E-116 |
| sp|C3P5L5|IF2_BACAA | Translation initiation factor IF-2 OS=Bacillus anthracis (strain A0248) GN=infB PE=3 SV=1 | 244 | 843 | 4.0E-116 |
| sp|B7IUH1|IF2_BACC2 | Translation initiation factor IF-2 OS=Bacillus cereus (strain G9842) GN=infB PE=3 SV=1 | 244 | 843 | 5.0E-116 |
| sp|B6ENE2|IF2_ALISL | Translation initiation factor IF-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=infB PE=3 SV=1 | 241 | 847 | 6.0E-116 |
| sp|B4RC55|IF2_PHEZH | Translation initiation factor IF-2 OS=Phenylobacterium zucineum (strain HLK1) GN=infB PE=3 SV=1 | 237 | 843 | 6.0E-116 |
| sp|B5FA79|IF2_VIBFM | Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 | 241 | 847 | 9.0E-116 |
| sp|A5GF86|IF2_GEOUR | Translation initiation factor IF-2 OS=Geobacter uraniireducens (strain Rf4) GN=infB PE=3 SV=1 | 227 | 848 | 1.0E-115 |
| sp|B8I6E7|IF2_CLOCE | Translation initiation factor IF-2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-115 |
| sp|A1TSK3|IF2_ACIAC | Translation initiation factor IF-2 OS=Acidovorax citrulli (strain AAC00-1) GN=infB PE=3 SV=1 | 212 | 847 | 1.0E-115 |
| sp|B2V4G9|IF2_CLOBA | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-115 |
| sp|B7VJH7|IF2_VIBTL | Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 | 241 | 847 | 2.0E-115 |
| sp|B8FCY5|IF2_DESAA | Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 | 213 | 843 | 2.0E-115 |
| sp|Q1QSZ0|IF2_CHRSD | Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 | 243 | 847 | 2.0E-115 |
| sp|A4J5X2|IF2_DESRM | Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 | 190 | 843 | 2.0E-115 |
| sp|B9M1G0|IF2_GEODF | Translation initiation factor IF-2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=infB PE=3 SV=1 | 212 | 844 | 3.0E-115 |
| sp|C4K3F0|IF2_HAMD5 | Translation initiation factor IF-2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-115 |
| sp|Q9ZF22|IF2_PROVU | Translation initiation factor IF-2 OS=Proteus vulgaris GN=infB PE=3 SV=1 | 107 | 847 | 5.0E-115 |
| sp|Q1AW55|IF2_RUBXD | Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 | 251 | 849 | 5.0E-115 |
| sp|Q2IPZ7|IF2_ANADE | Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 | 237 | 844 | 5.0E-115 |
| sp|A8GNW1|IF2_RICAH | Translation initiation factor IF-2 OS=Rickettsia akari (strain Hartford) GN=infB PE=3 SV=1 | 243 | 848 | 6.0E-115 |
| sp|A7GRE3|IF2_BACCN | Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 | 244 | 843 | 6.0E-115 |
| sp|B8CW72|IF2_HALOH | Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 | 218 | 843 | 6.0E-115 |
| sp|A9HF18|IF2_GLUDA | Translation initiation factor IF-2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=infB PE=3 SV=1 | 243 | 844 | 6.0E-115 |
| sp|Q9AC25|IF2_CAUCR | Translation initiation factor IF-2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=infB PE=3 SV=2 | 237 | 848 | 7.0E-115 |
| sp|Q1MQY8|IF2_LAWIP | Translation initiation factor IF-2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=infB PE=3 SV=1 | 209 | 852 | 8.0E-115 |
| sp|Q87M02|IF2_VIBPA | Translation initiation factor IF-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=infB PE=3 SV=1 | 241 | 847 | 9.0E-115 |
| sp|B0T167|IF2_CAUSK | Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 | 243 | 848 | 1.0E-114 |
| sp|A1W8Z4|IF2_ACISJ | Translation initiation factor IF-2 OS=Acidovorax sp. (strain JS42) GN=infB PE=3 SV=1 | 242 | 847 | 1.0E-114 |
| sp|Q8CST4|IF2_STAES | Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-114 |
| sp|Q5HPS2|IF2_STAEQ | Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-114 |
| sp|Q049V5|IF2_LACDB | Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=infB PE=3 SV=1 | 164 | 850 | 8.0E-114 |
| sp|A9VT50|IF2_BACWK | Translation initiation factor IF-2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-113 |
| sp|B9EBE9|IF2_MACCJ | Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 | 133 | 843 | 1.0E-113 |
| sp|C4Z5N7|IF2_EUBE2 | Translation initiation factor IF-2 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=infB PE=3 SV=1 | 246 | 849 | 1.0E-113 |
| sp|B8D7R4|IF2_BUCAT | Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=infB PE=3 SV=1 | 243 | 852 | 1.0E-113 |
| sp|P57458|IF2_BUCAI | Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=infB PE=3 SV=1 | 243 | 852 | 2.0E-113 |
| sp|B8D9G2|IF2_BUCA5 | Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=infB PE=3 SV=1 | 243 | 852 | 2.0E-113 |
| sp|Q1G9P9|IF2_LACDA | Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=infB PE=3 SV=1 | 164 | 847 | 2.0E-113 |
| sp|B4S4S6|IF2_PROA2 | Translation initiation factor IF-2 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=infB PE=3 SV=1 | 244 | 848 | 2.0E-113 |
| sp|B3EFB1|IF2_CHLL2 | Translation initiation factor IF-2 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=infB PE=3 SV=1 | 323 | 848 | 2.0E-113 |
| sp|B2GBN7|IF2_LACF3 | Translation initiation factor IF-2 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=infB PE=3 SV=1 | 255 | 849 | 2.0E-113 |
| sp|Q6A7M5|IF2_PROAC | Translation initiation factor IF-2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=infB PE=3 SV=1 | 255 | 849 | 2.0E-113 |
| sp|Q74IS8|IF2_LACJO | Translation initiation factor IF-2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=infB PE=3 SV=1 | 255 | 849 | 2.0E-113 |
| sp|A0Q0Q7|IF2_CLONN | Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 | 246 | 843 | 3.0E-113 |
| sp|P46199|IF2M_HUMAN | Translation initiation factor IF-2, mitochondrial OS=Homo sapiens GN=MTIF2 PE=1 SV=2 | 317 | 844 | 3.0E-113 |
| sp|Q2NC10|IF2_ERYLH | Translation initiation factor IF-2 OS=Erythrobacter litoralis (strain HTCC2594) GN=infB PE=3 SV=1 | 243 | 838 | 4.0E-113 |
| sp|Q044B7|IF2_LACGA | Translation initiation factor IF-2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=infB PE=3 SV=1 | 255 | 849 | 4.0E-113 |
| sp|Q9PGR3|IF2_XYLFA | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-113 |
| sp|Q21H61|IF2_SACD2 | Translation initiation factor IF-2 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=infB PE=3 SV=1 | 243 | 847 | 4.0E-113 |
| sp|A1WLI3|IF2_VEREI | Translation initiation factor IF-2 OS=Verminephrobacter eiseniae (strain EF01-2) GN=infB PE=3 SV=1 | 242 | 843 | 5.0E-113 |
| sp|B0U1Q8|IF2_XYLFM | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-113 |
| sp|Q49X54|IF2_STAS1 | Translation initiation factor IF-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=infB PE=3 SV=1 | 250 | 847 | 6.0E-113 |
| sp|C0QHM2|IF2_DESAH | Translation initiation factor IF-2 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=infB PE=3 SV=1 | 195 | 848 | 7.0E-113 |
| sp|A5N842|IF2_CLOK5 | Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 | 238 | 843 | 8.0E-113 |
| sp|Q87EV4|IF2_XYLFT | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-113 |
| sp|B2I726|IF2_XYLF2 | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M23) GN=infB PE=3 SV=1 | 243 | 847 | 9.0E-113 |
| sp|B8J1Y4|IF2_DESDA | Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 | 236 | 852 | 1.0E-112 |
| sp|Q2SML3|IF2_HAHCH | Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 | 136 | 846 | 1.0E-112 |
| sp|B5ZBC9|IF2_UREU1 | Translation initiation factor IF-2 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=infB PE=3 SV=1 | 248 | 848 | 1.0E-112 |
| sp|A6LSQ4|IF2_CLOB8 | Translation initiation factor IF-2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=infB PE=3 SV=1 | 244 | 843 | 1.0E-112 |
| sp|Q97I51|IF2_CLOAB | Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 | 326 | 847 | 1.0E-112 |
| sp|A8EYF4|IF2_RICCK | Translation initiation factor IF-2 OS=Rickettsia canadensis (strain McKiel) GN=infB PE=3 SV=1 | 243 | 848 | 2.0E-112 |
| sp|B0JU67|IF2_MICAN | Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 | 244 | 848 | 2.0E-112 |
| sp|Q4L5X1|IF2_STAHJ | Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 | 250 | 847 | 3.0E-112 |
| sp|Q73NP6|IF2_TREDE | Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 | 244 | 847 | 5.0E-112 |
| sp|Q72ER1|IF2_DESVH | Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 | 236 | 852 | 5.0E-112 |
| sp|A4SGG2|IF2_CHLPM | Translation initiation factor IF-2 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=infB PE=3 SV=1 | 209 | 847 | 5.0E-112 |
| sp|A1VG83|IF2_DESVV | Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 | 244 | 852 | 6.0E-112 |
| sp|Q6MD64|IF2_PARUW | Translation initiation factor IF-2 OS=Protochlamydia amoebophila (strain UWE25) GN=infB PE=3 SV=1 | 207 | 843 | 6.0E-112 |
| sp|Q6LUJ2|IF2_PHOPR | Translation initiation factor IF-2 OS=Photobacterium profundum GN=infB PE=3 SV=1 | 206 | 847 | 7.0E-112 |
| sp|C0QTL9|IF2_PERMH | Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 | 246 | 848 | 9.0E-112 |
| sp|Q9PQH1|IF2_UREPA | Translation initiation factor IF-2 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=infB PE=3 SV=1 | 248 | 848 | 9.0E-112 |
| sp|B1AIV8|IF2_UREP2 | Translation initiation factor IF-2 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=infB PE=3 SV=1 | 248 | 848 | 9.0E-112 |
| sp|Q8NWZ1|IF2_STAAW | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-111 |
| sp|Q6G9U4|IF2_STAAS | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-111 |
| sp|A5CEN6|IF2_ORITB | Translation initiation factor IF-2 OS=Orientia tsutsugamushi (strain Boryong) GN=infB PE=3 SV=1 | 236 | 852 | 1.0E-111 |
| sp|Q6GHG6|IF2_STAAR | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-111 |
| sp|Q8K9H1|IF2_BUCAP | Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 | 216 | 852 | 1.0E-111 |
| sp|Q1LSK8|IF2_BAUCH | Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 | 161 | 846 | 1.0E-111 |
| sp|Q609C0|IF2_METCA | Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-111 |
| sp|P65134|IF2_STAAN | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 | 250 | 847 | 2.0E-111 |
| sp|P65133|IF2_STAAM | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|Q2YXP7|IF2_STAAB | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|A5ISF3|IF2_STAA9 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|A6U188|IF2_STAA2 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|A7X1Q1|IF2_STAA1 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|Q2G5E7|IF2_NOVAD | Translation initiation factor IF-2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=infB PE=3 SV=1 | 243 | 844 | 2.0E-111 |
| sp|A8Z3U9|IF2_STAAT | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|A6QGG8|IF2_STAAE | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|Q5HGG2|IF2_STAAC | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|Q2G2D0|IF2_STAA8 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|Q2FHG9|IF2_STAA3 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 | 250 | 847 | 2.0E-111 |
| sp|A1BDF1|IF2_CHLPD | Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 | 319 | 848 | 3.0E-111 |
| sp|Q38W81|IF2_LACSS | Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 | 230 | 849 | 5.0E-111 |
| sp|B2A397|IF2_NATTJ | Translation initiation factor IF-2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=infB PE=3 SV=1 | 326 | 843 | 5.0E-111 |
| sp|A0LE19|IF2_MAGMM | Translation initiation factor IF-2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=infB PE=3 SV=1 | 243 | 843 | 5.0E-111 |
| sp|Q1GVI9|IF2_SPHAL | Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 | 185 | 844 | 6.0E-111 |
| sp|B8HUA9|IF2_CYAP4 | Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 | 244 | 848 | 7.0E-111 |
| sp|Q7U8L9|IF2_SYNPX | Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 | 237 | 846 | 1.0E-110 |
| sp|B3ELN8|IF2_CHLPB | Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain BS1) GN=infB PE=3 SV=1 | 325 | 848 | 2.0E-110 |
| sp|Q5WFU2|IF2_BACSK | Translation initiation factor IF-2 OS=Bacillus clausii (strain KSM-K16) GN=infB PE=3 SV=1 | 214 | 843 | 2.0E-110 |
| sp|Q3B1Z8|IF2_CHLL7 | Translation initiation factor IF-2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=infB PE=3 SV=1 | 209 | 848 | 2.0E-110 |
| sp|A7GZZ3|IF2_CAMC5 | Translation initiation factor IF-2 OS=Campylobacter curvus (strain 525.92) GN=infB PE=3 SV=1 | 209 | 852 | 3.0E-110 |
| sp|P18311|IF2_ENTFC | Translation initiation factor IF-2 OS=Enterococcus faecium GN=infB PE=3 SV=1 | 250 | 843 | 3.0E-110 |
| sp|Q31LL9|IF2_SYNE7 | Translation initiation factor IF-2 OS=Synechococcus elongatus (strain PCC 7942) GN=infB PE=3 SV=1 | 319 | 848 | 3.0E-110 |
| sp|A9M1D5|IF2_NEIM0 | Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-110 |
| sp|Q9JTB5|IF2_NEIMA | Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=infB PE=3 SV=1 | 243 | 847 | 5.0E-110 |
| sp|O83861|IF2_TREPA | Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 | 235 | 847 | 6.0E-110 |
| sp|O67825|IF2_AQUAE | Translation initiation factor IF-2 OS=Aquifex aeolicus (strain VF5) GN=infB PE=3 SV=1 | 244 | 849 | 8.0E-110 |
| sp|A1KV51|IF2_NEIMF | Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-109 |
| sp|P9WKK1|IF2_MYCTU | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=infB PE=1 SV=1 | 211 | 848 | 1.0E-109 |
| sp|P9WKK0|IF2_MYCTO | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=infB PE=3 SV=1 | 211 | 848 | 1.0E-109 |
| sp|A5U6J1|IF2_MYCTA | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=infB PE=3 SV=1 | 211 | 848 | 1.0E-109 |
| sp|C1AFV3|IF2_MYCBT | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=infB PE=3 SV=1 | 211 | 848 | 1.0E-109 |
| sp|A1KMI2|IF2_MYCBP | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=infB PE=3 SV=1 | 211 | 848 | 1.0E-109 |
| sp|P65132|IF2_MYCBO | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=infB PE=3 SV=1 | 211 | 848 | 1.0E-109 |
| sp|Q5FJN6|IF2_LACAC | Translation initiation factor IF-2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=infB PE=3 SV=1 | 127 | 844 | 1.0E-109 |
| sp|A7ZC69|IF2_CAMC1 | Translation initiation factor IF-2 OS=Campylobacter concisus (strain 13826) GN=infB PE=3 SV=1 | 209 | 852 | 1.0E-109 |
| sp|Q9JYD2|IF2_NEIMB | Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=infB PE=3 SV=1 | 243 | 847 | 1.0E-109 |
| sp|Q3A4A7|IF2_PELCD | Translation initiation factor IF-2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=infB PE=3 SV=1 | 244 | 847 | 1.0E-109 |
| sp|A6QBQ5|IF2_SULNB | Translation initiation factor IF-2 OS=Sulfurovum sp. (strain NBC37-1) GN=infB PE=3 SV=1 | 244 | 848 | 1.0E-109 |
| sp|Q7VHF6|IF2_HELHP | Translation initiation factor IF-2 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=infB PE=3 SV=1 | 244 | 852 | 2.0E-109 |
| sp|B3QQI2|IF2_CHLP8 | Translation initiation factor IF-2 OS=Chlorobaculum parvum (strain NCIB 8327) GN=infB PE=3 SV=1 | 323 | 848 | 2.0E-109 |
| sp|A9KNW4|IF2_CLOPH | Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 | 319 | 849 | 2.0E-109 |
| sp|Q8KFT1|IF2_CHLTE | Translation initiation factor IF-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=infB PE=3 SV=1 | 323 | 848 | 3.0E-109 |
| sp|Q493T7|IF2_BLOPB | Translation initiation factor IF-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=infB PE=3 SV=1 | 243 | 847 | 3.0E-109 |
| sp|B1II49|IF2_CLOBK | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 | 323 | 843 | 3.0E-109 |
| sp|B1KWK7|IF2_CLOBM | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 | 323 | 843 | 4.0E-109 |
| sp|Q1IIT3|IF2_KORVE | Translation initiation factor IF-2 OS=Koribacter versatilis (strain Ellin345) GN=infB PE=3 SV=1 | 243 | 845 | 4.0E-109 |
| sp|B8ZM93|IF2_STRPJ | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=infB PE=3 SV=1 | 250 | 843 | 4.0E-109 |
| sp|Q2JSB7|IF2_SYNJA | Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=infB PE=3 SV=1 | 249 | 848 | 5.0E-109 |
| sp|A0PQC4|IF2_MYCUA | Translation initiation factor IF-2 OS=Mycobacterium ulcerans (strain Agy99) GN=infB PE=3 SV=1 | 211 | 848 | 6.0E-109 |
| sp|B3WER5|IF2_LACCB | Translation initiation factor IF-2 OS=Lactobacillus casei (strain BL23) GN=infB PE=3 SV=1 | 228 | 849 | 6.0E-109 |
| sp|Q038M5|IF2_LACC3 | Translation initiation factor IF-2 OS=Lactobacillus casei (strain ATCC 334) GN=infB PE=3 SV=1 | 228 | 849 | 7.0E-109 |
| sp|B5E266|IF2_STRP4 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=infB PE=3 SV=1 | 250 | 843 | 7.0E-109 |
| sp|B2HKS2|IF2_MYCMM | Translation initiation factor IF-2 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=infB PE=3 SV=1 | 211 | 848 | 8.0E-109 |
| sp|C1CQ48|IF2_STRZT | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=infB PE=3 SV=1 | 250 | 843 | 1.0E-108 |
| sp|C1C5S8|IF2_STRP7 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain 70585) GN=infB PE=3 SV=1 | 250 | 843 | 1.0E-108 |
| sp|A9BCI5|IF2_PROM4 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 | 237 | 848 | 1.0E-108 |
| sp|C5BPV9|IF2_TERTT | Translation initiation factor IF-2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=infB PE=3 SV=1 | 244 | 847 | 1.0E-108 |
| sp|Q5YSC6|IF2_NOCFA | Translation initiation factor IF-2 OS=Nocardia farcinica (strain IFM 10152) GN=infB PE=3 SV=2 | 211 | 849 | 1.0E-108 |
| sp|C1CCT8|IF2_STRZJ | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain JJA) GN=infB PE=3 SV=1 | 250 | 843 | 1.0E-108 |
| sp|Q8DQV2|IF2_STRR6 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=infB PE=3 SV=1 | 250 | 843 | 1.0E-108 |
| sp|Q04LW0|IF2_STRP2 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=infB PE=3 SV=1 | 250 | 843 | 1.0E-108 |
| sp|P55875|IF2_STIAU | Translation initiation factor IF-2 OS=Stigmatella aurantiaca GN=infB PE=3 SV=1 | 250 | 847 | 1.0E-108 |
| sp|Q7VA20|IF2_PROMA | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 | 239 | 846 | 2.0E-108 |
| sp|A6VU29|IF2_MARMS | Translation initiation factor IF-2 OS=Marinomonas sp. (strain MWYL1) GN=infB PE=3 SV=1 | 188 | 847 | 2.0E-108 |
| sp|B2IME4|IF2_STRPS | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain CGSP14) GN=infB PE=3 SV=1 | 250 | 843 | 2.0E-108 |
| sp|Q97S57|IF2_STRPN | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=infB PE=3 SV=1 | 250 | 843 | 2.0E-108 |
| sp|A5I4J3|IF2_CLOBH | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 | 323 | 843 | 2.0E-108 |
| sp|A7FVZ3|IF2_CLOB1 | Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 | 323 | 843 | 2.0E-108 |
| sp|C1CJ39|IF2_STRZP | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain P1031) GN=infB PE=3 SV=1 | 250 | 843 | 2.0E-108 |
| sp|Q5N0A5|IF2_SYNP6 | Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=infB PE=3 SV=1 | 319 | 848 | 3.0E-108 |
| sp|B6J6B1|IF2_COXB1 | Translation initiation factor IF-2 OS=Coxiella burnetii (strain CbuK_Q154) GN=infB PE=3 SV=1 | 207 | 844 | 3.0E-108 |
| sp|C1FS59|IF2_CLOBJ | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 | 323 | 843 | 3.0E-108 |
| sp|A9KBM1|IF2_COXBN | Translation initiation factor IF-2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=infB PE=3 SV=1 | 207 | 844 | 3.0E-108 |
| sp|B2GKR5|IF2_KOCRD | Translation initiation factor IF-2 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=infB PE=3 SV=1 | 255 | 849 | 4.0E-108 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 42.34 | 25.47 | 59.21 |
| Initials | Initials knots | 40.78 | 24.56 | 56.99 |
| Pileal_Stipeal_center | Stage I stipe center | 54.85 | 32.03 | 77.67 |
| Pileal_Stipeal_shell | Stage I stipe shell | 74.33 | 42.75 | 105.92 |
| DIF_stipe_center | Stage II stipe center | 69.33 | 41.12 | 97.54 |
| DIF_stipe_shell | Stage II stipe shell | 64.71 | 38.26 | 91.15 |
| DIF_stipe_skin | Stage II stipe skin | 59.06 | 35.26 | 82.85 |
| DIF_cap_skin | Stage II cap skin | 76.50 | 44.55 | 108.45 |
| DIF_cap_tissue | Stage II cap tissue | 84.28 | 49.22 | 119.34 |
| DIF_gill_tissue | Stage II gill tissue | 81.75 | 47.84 | 115.66 |
| YFB_stipe_center | Young fruiting body stipe center | 56.30 | 33.71 | 78.90 |
| YFB_stipe_shell | Young fruiting body stipe shell | 61.13 | 36.55 | 85.70 |
| YFB_stipe_skin | Young fruiting body stipe skin | 63.20 | 37.71 | 88.69 |
| YFB_cap_skin | Young fruiting body cap skin | 61.67 | 36.83 | 86.52 |
| YFB_cap_tissue | Young fruiting body cap tissue | 65.94 | 39.32 | 92.56 |
| YFB_gill_tissue | Young fruiting body gill tissue | 62.74 | 37.02 | 88.46 |
| YFB_veil | Young fruiting body veil | 77.58 | 45.68 | 109.49 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.011350 | yes |
| Casing | YFB_stipe_center | 0.377517 | no |
| Casing | YFB_stipe_shell | 0.214244 | no |
| Casing | YFB_stipe_skin | 0.157706 | no |
| Casing | YFB_cap_skin | 0.199497 | no |
| Casing | YFB_cap_tissue | 0.114271 | no |
| Casing | YFB_gill_tissue | 0.172181 | no |
| Casing | YFB_veil | 0.018066 | yes |
| Casing | Initials | 0.943318 | no |
| Casing | Pileal_Stipeal_center | 0.448116 | no |
| Casing | Pileal_Stipeal_shell | 0.038495 | yes |
| Casing | DIF_stipe_center | 0.071226 | no |
| Casing | DIF_stipe_shell | 0.131844 | no |
| Casing | DIF_stipe_skin | 0.268874 | no |
| Casing | DIF_cap_skin | 0.023933 | yes |
| Casing | DIF_cap_tissue | 0.007092 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.211119 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.379525 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.446851 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.395587 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.560248 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.437868 | no |
| DIF_gill_tissue | YFB_veil | 0.921651 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.865717 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.788616 | no |
| YFB_stipe_center | YFB_cap_skin | 0.843414 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.694255 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.810684 | no |
| YFB_stipe_center | YFB_veil | 0.314250 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.950430 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.986473 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.878385 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.963168 | no |
| YFB_stipe_shell | YFB_veil | 0.501599 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.962818 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.936255 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.989597 | no |
| YFB_stipe_skin | YFB_veil | 0.580907 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.894140 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.975758 | no |
| YFB_cap_skin | YFB_veil | 0.520249 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.925025 | no |
| YFB_cap_tissue | YFB_veil | 0.685889 | no |
| YFB_gill_tissue | YFB_veil | 0.560104 | no |
| Initials | DIF_gill_tissue | 0.005671 | yes |
| Initials | YFB_stipe_center | 0.297581 | no |
| Initials | YFB_stipe_shell | 0.157440 | no |
| Initials | YFB_stipe_skin | 0.114888 | no |
| Initials | YFB_cap_skin | 0.144431 | no |
| Initials | YFB_cap_tissue | 0.077698 | no |
| Initials | YFB_gill_tissue | 0.125429 | no |
| Initials | YFB_veil | 0.010412 | yes |
| Initials | Pileal_Stipeal_center | 0.365564 | no |
| Initials | Pileal_Stipeal_shell | 0.025205 | yes |
| Initials | DIF_stipe_center | 0.044631 | yes |
| Initials | DIF_stipe_shell | 0.092165 | no |
| Initials | DIF_stipe_skin | 0.210655 | no |
| Initials | DIF_cap_skin | 0.014668 | yes |
| Initials | DIF_cap_tissue | 0.002951 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.188910 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.962428 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.816353 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.732888 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.792809 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.639833 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.756416 | no |
| Pileal_Stipeal_center | YFB_veil | 0.277880 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.366862 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.517682 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.685390 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.883497 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.302508 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.147141 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.843109 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.413030 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.618223 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.687252 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.633307 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.790108 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.678045 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.936967 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.891059 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.749837 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.530481 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.958490 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.778532 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.682606 | no |
| DIF_stipe_center | YFB_stipe_center | 0.573429 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.773189 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.841810 | no |
| DIF_stipe_center | YFB_cap_skin | 0.790083 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.924075 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.830538 | no |
| DIF_stipe_center | YFB_veil | 0.800882 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.892096 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.689117 | no |
| DIF_stipe_center | DIF_cap_skin | 0.834647 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.606700 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.510081 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.741315 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.912597 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.964497 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.924896 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.972008 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.955124 | no |
| DIF_stipe_shell | YFB_veil | 0.635725 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.847870 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.674375 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.437018 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.305693 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.929584 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.951299 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.892176 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.934810 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.809250 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.908127 | no |
| DIF_stipe_skin | YFB_veil | 0.421702 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.451366 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.247801 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.898345 | no |
| DIF_cap_skin | YFB_stipe_center | 0.347312 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.539308 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.613603 | no |
| DIF_cap_skin | YFB_cap_skin | 0.555552 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.724478 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.600056 | no |
| DIF_cap_skin | YFB_veil | 0.980041 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.839004 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.956200 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.164759 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.317511 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.377838 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.331527 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.488553 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.368074 | no |
| DIF_cap_tissue | YFB_veil | 0.866332 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|058620 MRRRSLLPILRQSGQTRTAATAARIRLTDGPAEPSPTPSKWAPLQFDKGVPTAKSWARPSAPTSKREPPHLEKFL QSPQTSSRLATPLRKPSSNKWSPLSSVPDRNLNRNLNRDQRWKQRPNSQKELQPSRGLLSRKQPAATEDVKKSGS ISQETVVTQEPETFSDEPELDETQGDLWESRDASRASRQRANNYKTRGSVVQKLHNDEKHRRSRPENRENTQPES TKSPKINLPRLKAKPRMDVYIPSTVTVGRLAKILNMKLNYLIRKMIEAGMGEEAIHDHVLTSDYAVLLAEELGRN PIVDDEAAFDLYPPTLRPDSSCLSLRPPIVTIMGHVDHGKTTLLDTLRSSAVAKGEAGGITQHIGAFSVPVNSSQ GQHHITFLDTPGHAAFSAMRERGASTTDIVVLVVAADDGIMPQTKEVINLLKKDTGNVGHVVAINKIDKPDANAA TVKLALMAEGIQLESFGGDVPSVEVSGLTGKGLPELVETLAAMAEVQDLRAEKEGAVHGYVLESRVTKGLGPVAT ILVLRGSLKTGSHCLSGAHMAKVRLMTDSNGKSVKVATPGMAVTVSGWKTLPKAGDEVLDGKESDVKKALANRVR MAGIAASLADVDAINATRKEERERKKAEVNKTDNHIDPVAEADGPKELKLIIKADVSGSAEAIEGALQGIGNKEA MTKIVSAGVGDVTDSDVLMAKAVNATIVAFSVSVPRSVQSAAAQNAVPITESPIIYHLMEDVRKRVAALLPTITE TTVTGEASVLQLFDIHLKAKEVKKIAGCRVVNGLIEKAKFARIVRDGSVIHDGSLDTMRVLKKDVTEVRKGSECG LSFVNFADLREGDLIQMYQTIEKPGVL* |
| Coding | >AgabiH97|058620 ATGCGCCGACGATCATTGCTGCCAATACTGCGCCAGTCTGGTCAAACTCGGACAGCAGCCACAGCAGCTAGAATA AGGTTAACAGACGGCCCGGCAGAACCGTCACCTACCCCCTCCAAATGGGCTCCTCTGCAATTTGACAAAGGAGTG CCCACCGCTAAATCATGGGCTCGCCCGAGCGCCCCTACCAGCAAGCGAGAACCTCCACATTTAGAAAAGTTCCTG CAATCACCGCAAACTTCTTCCCGTCTTGCAACCCCCCTTCGTAAACCATCCTCCAACAAATGGTCTCCATTATCA TCTGTGCCTGACCGCAATTTAAACCGCAATCTGAATCGCGATCAACGTTGGAAACAGAGGCCAAACAGTCAGAAG GAACTACAGCCCTCCAGAGGTCTACTCAGCAGGAAGCAACCAGCTGCGACGGAGGATGTAAAGAAAAGCGGAAGC ATTTCTCAAGAAACTGTAGTGACTCAAGAACCAGAGACTTTTAGTGATGAGCCGGAGCTAGACGAAACCCAAGGC GACTTATGGGAGTCCAGGGATGCTTCGCGGGCAAGTCGCCAGCGTGCAAATAATTACAAGACCCGCGGTTCTGTG GTACAAAAACTTCACAATGATGAAAAACACCGGAGATCTCGACCTGAAAATCGAGAGAATACCCAACCTGAGAGC ACGAAGAGCCCTAAAATAAACCTTCCCCGTCTGAAGGCTAAACCTCGAATGGACGTGTACATCCCATCGACAGTG ACTGTCGGTAGACTGGCGAAGATACTGAATATGAAACTAAACTACCTCATTCGCAAGATGATTGAAGCCGGGATG GGAGAGGAAGCAATTCATGATCATGTCTTAACTTCTGATTATGCGGTTCTCCTGGCTGAAGAACTTGGGCGAAAT CCCATCGTTGATGATGAAGCTGCCTTCGATCTATACCCTCCCACATTACGCCCTGATTCCTCCTGTCTGTCCCTC CGACCACCTATTGTAACAATCATGGGGCACGTAGACCATGGCAAAACGACGCTGCTTGATACACTTCGATCCTCA GCAGTCGCCAAAGGGGAAGCAGGAGGCATTACTCAACATATTGGAGCCTTTTCCGTTCCAGTAAATTCATCACAA GGACAGCACCACATCACATTCCTTGATACTCCAGGTCATGCTGCATTTTCAGCTATGCGAGAACGGGGCGCTAGT ACCACAGATATCGTGGTACTTGTTGTAGCCGCAGATGACGGTATCATGCCCCAAACTAAGGAAGTGATTAACCTT CTCAAAAAAGACACTGGTAATGTTGGTCACGTCGTTGCTATTAACAAGATCGACAAGCCGGATGCCAATGCTGCA ACTGTCAAATTGGCGCTGATGGCGGAAGGCATTCAGCTGGAATCGTTTGGCGGTGATGTGCCTTCTGTGGAGGTA TCCGGTTTGACAGGCAAGGGCCTTCCAGAGCTCGTAGAAACATTAGCAGCGATGGCGGAAGTGCAGGACCTCCGC GCCGAAAAGGAGGGTGCTGTTCACGGTTATGTGCTGGAGTCAAGGGTAACAAAGGGATTAGGTCCTGTCGCCACA ATTCTGGTGTTGCGAGGATCCCTCAAAACAGGCTCTCATTGTTTAAGTGGCGCTCACATGGCCAAAGTCCGCCTC ATGACTGACTCAAATGGAAAAAGTGTCAAAGTCGCAACTCCTGGTATGGCAGTTACTGTGTCGGGCTGGAAAACG CTGCCAAAGGCCGGAGATGAAGTACTTGATGGCAAAGAGTCAGATGTGAAGAAGGCGCTGGCAAATCGAGTGCGA ATGGCAGGCATTGCCGCCTCGTTGGCTGACGTAGATGCTATCAATGCTACAAGGAAAGAAGAGCGGGAACGGAAA AAAGCAGAGGTTAACAAGACCGATAATCATATCGATCCTGTTGCAGAGGCTGACGGCCCTAAAGAGCTGAAATTG ATCATAAAAGCTGATGTGAGTGGGAGTGCGGAAGCAATTGAAGGGGCATTGCAAGGCATTGGAAACAAGGAGGCT ATGACAAAAATTGTGTCTGCCGGTGTTGGAGATGTTACAGATTCGGACGTGCTCATGGCAAAAGCTGTAAATGCC ACTATCGTTGCCTTCTCGGTCTCAGTTCCCCGCTCGGTGCAGAGTGCGGCAGCGCAAAATGCTGTGCCTATAACT GAGTCTCCGATTATTTACCATTTAATGGAGGACGTTCGTAAAAGAGTGGCTGCGCTTCTACCTACAATCACAGAG ACAACAGTGACTGGTGAAGCATCGGTTCTCCAGTTGTTCGACATTCATCTCAAGGCCAAAGAAGTGAAAAAGATT GCTGGCTGTCGCGTGGTCAATGGTCTGATTGAGAAGGCTAAATTTGCACGAATCGTTAGAGACGGTTCCGTCATA CACGATGGATCCTTGGACACCATGCGCGTCCTCAAGAAAGATGTGACTGAGGTGCGAAAAGGCTCAGAGTGTGGC TTGAGCTTCGTAAATTTTGCGGATCTTCGCGAAGGCGATTTAATTCAGATGTACCAGACCATAGAAAAACCTGGG GTTTTGTAA |
| Transcript | >AgabiH97|058620 ATGCGCCGACGATCATTGCTGCCAATACTGCGCCAGTCTGGTCAAACTCGGACAGCAGCCACAGCAGCTAGAATA AGGTTAACAGACGGCCCGGCAGAACCGTCACCTACCCCCTCCAAATGGGCTCCTCTGCAATTTGACAAAGGAGTG CCCACCGCTAAATCATGGGCTCGCCCGAGCGCCCCTACCAGCAAGCGAGAACCTCCACATTTAGAAAAGTTCCTG CAATCACCGCAAACTTCTTCCCGTCTTGCAACCCCCCTTCGTAAACCATCCTCCAACAAATGGTCTCCATTATCA TCTGTGCCTGACCGCAATTTAAACCGCAATCTGAATCGCGATCAACGTTGGAAACAGAGGCCAAACAGTCAGAAG GAACTACAGCCCTCCAGAGGTCTACTCAGCAGGAAGCAACCAGCTGCGACGGAGGATGTAAAGAAAAGCGGAAGC ATTTCTCAAGAAACTGTAGTGACTCAAGAACCAGAGACTTTTAGTGATGAGCCGGAGCTAGACGAAACCCAAGGC GACTTATGGGAGTCCAGGGATGCTTCGCGGGCAAGTCGCCAGCGTGCAAATAATTACAAGACCCGCGGTTCTGTG GTACAAAAACTTCACAATGATGAAAAACACCGGAGATCTCGACCTGAAAATCGAGAGAATACCCAACCTGAGAGC ACGAAGAGCCCTAAAATAAACCTTCCCCGTCTGAAGGCTAAACCTCGAATGGACGTGTACATCCCATCGACAGTG ACTGTCGGTAGACTGGCGAAGATACTGAATATGAAACTAAACTACCTCATTCGCAAGATGATTGAAGCCGGGATG GGAGAGGAAGCAATTCATGATCATGTCTTAACTTCTGATTATGCGGTTCTCCTGGCTGAAGAACTTGGGCGAAAT CCCATCGTTGATGATGAAGCTGCCTTCGATCTATACCCTCCCACATTACGCCCTGATTCCTCCTGTCTGTCCCTC CGACCACCTATTGTAACAATCATGGGGCACGTAGACCATGGCAAAACGACGCTGCTTGATACACTTCGATCCTCA GCAGTCGCCAAAGGGGAAGCAGGAGGCATTACTCAACATATTGGAGCCTTTTCCGTTCCAGTAAATTCATCACAA GGACAGCACCACATCACATTCCTTGATACTCCAGGTCATGCTGCATTTTCAGCTATGCGAGAACGGGGCGCTAGT ACCACAGATATCGTGGTACTTGTTGTAGCCGCAGATGACGGTATCATGCCCCAAACTAAGGAAGTGATTAACCTT CTCAAAAAAGACACTGGTAATGTTGGTCACGTCGTTGCTATTAACAAGATCGACAAGCCGGATGCCAATGCTGCA ACTGTCAAATTGGCGCTGATGGCGGAAGGCATTCAGCTGGAATCGTTTGGCGGTGATGTGCCTTCTGTGGAGGTA TCCGGTTTGACAGGCAAGGGCCTTCCAGAGCTCGTAGAAACATTAGCAGCGATGGCGGAAGTGCAGGACCTCCGC GCCGAAAAGGAGGGTGCTGTTCACGGTTATGTGCTGGAGTCAAGGGTAACAAAGGGATTAGGTCCTGTCGCCACA ATTCTGGTGTTGCGAGGATCCCTCAAAACAGGCTCTCATTGTTTAAGTGGCGCTCACATGGCCAAAGTCCGCCTC ATGACTGACTCAAATGGAAAAAGTGTCAAAGTCGCAACTCCTGGTATGGCAGTTACTGTGTCGGGCTGGAAAACG CTGCCAAAGGCCGGAGATGAAGTACTTGATGGCAAAGAGTCAGATGTGAAGAAGGCGCTGGCAAATCGAGTGCGA ATGGCAGGCATTGCCGCCTCGTTGGCTGACGTAGATGCTATCAATGCTACAAGGAAAGAAGAGCGGGAACGGAAA AAAGCAGAGGTTAACAAGACCGATAATCATATCGATCCTGTTGCAGAGGCTGACGGCCCTAAAGAGCTGAAATTG ATCATAAAAGCTGATGTGAGTGGGAGTGCGGAAGCAATTGAAGGGGCATTGCAAGGCATTGGAAACAAGGAGGCT ATGACAAAAATTGTGTCTGCCGGTGTTGGAGATGTTACAGATTCGGACGTGCTCATGGCAAAAGCTGTAAATGCC ACTATCGTTGCCTTCTCGGTCTCAGTTCCCCGCTCGGTGCAGAGTGCGGCAGCGCAAAATGCTGTGCCTATAACT GAGTCTCCGATTATTTACCATTTAATGGAGGACGTTCGTAAAAGAGTGGCTGCGCTTCTACCTACAATCACAGAG ACAACAGTGACTGGTGAAGCATCGGTTCTCCAGTTGTTCGACATTCATCTCAAGGCCAAAGAAGTGAAAAAGATT GCTGGCTGTCGCGTGGTCAATGGTCTGATTGAGAAGGCTAAATTTGCACGAATCGTTAGAGACGGTTCCGTCATA CACGATGGATCCTTGGACACCATGCGCGTCCTCAAGAAAGATGTGACTGAGGTGCGAAAAGGCTCAGAGTGTGGC TTGAGCTTCGTAAATTTTGCGGATCTTCGCGAAGGCGATTTAATTCAGATGTACCAGACCATAGAAAAACCTGGG GTTTTGTAA |
| Gene | >AgabiH97|058620 ATGCGCCGACGATCATTGCTGCCAATACTGCGCCAGTCTGGTCAAACTCGGACAGCAGCCACAGCAGCTAGAATA AGGGTGCGATAGCTTTCAAGCGCTCTGCCCATTCACAATGACCTTTCGCATTAGTTAACAGACGGCCCGGCAGAA CCGTCACCTACCCCCTCCAAATGGGCTCCTCTGCAATTTGACAAAGTACGTACGACCTCGTTAACCTACTTCGAG TAACGCCTTTACCTCTATCCCCAGGGAGTGCCCACCGCTAAATCATGGGCTCGCCCGAGCGCCCCTACCAGCAAG CGAGAACCTCCACATTTAGAAAGTCGTTTGTCTTCATCTGAATGTCAATGGTTTATGCGACTAATGCTCCGTAGA GTTCCTGCAATCACCGCAAACTTCTTCCCGTCTTGCAACCCCCCTTCGTAAACCATCCTCCAACAAATGGTCTCC ATTATCATCTGTGCCTGACCGCAATTTAAACCGCAATCTGAATCGCGATCAACGTTGGAAACAGAGGCCAAACAG TCAGAAGGAACTACAGCCCTCCAGAGGTCTACTCAGCAGGAAGCAACCAGCTGCGACGGAGGATGTAAAGAAAAG CGGAAGCATTTCTCAAGAAACTGTAGTGACTCAAGAACCAGAGACTTTTAGTGATGAGCCGGAGCTAGACGAAAC CCAAGGCGACTTATGGGAGTCCAGGGATGCTTCGCGGGCAAGTCGCCAGCGTGCAAATAATTACAAGACCCGCGG TTCTGTGGTACAAAAACTTCACAATGATGAAAAACACCGGAGATCTCGACCTGAAAATCGAGAGAATACCCAACC TGAGAGCACGAAGAGCCCTAAAATAAACCTTCCCCGTCTGAAGGCTAAACCTCGAATGGACGTGTACATCCCATC GACAGTGACTGTCGGTAGACTGGCGAAGATACTGAATATGAAACTAAGTATGAGATCATATCTGTTTTTCCTCGT GTCATTGCATTAGAACTAACACTTCGTTCAGACTACCTCATTCGCAAGATGATTGAAGCCGGGATGGGAGAGGAA GCAATTCATGATCATGGTAAACTTTTCCAAACGTGCCGTGCCACAACTAATCCTATCGTTATAGTCTTAACTTCT GATTATGCGGTTCTCCTGGCTGAAGAACTTGGGCGAAATCCCATCGTTGATGATGAAGCTGCCTTCGATCTATAC CCTCCGTGAGTGGACATATTGCGATAAGCTCCCTGATTTACCTCAAGCGCTCAGCACATTACGCCCTGATTCCTC CTGTCTGTCCCTCCGACCACCTATTGTAACAATCATGGGGCACGTAGACCATGGCAAAACGACGCTGCTTGATAC ACTTCGATCCTCAGCAGTCGCCAAAGGGGAAGCAGGAGGCATTACTCAACATATTGGAGCCTTTTCCGTTCCAGT AAATTCATCACAAGGACAGCACCACATCACATTCCTTGATACTCCAGGTCATGCTGCATTTTCAGCTATGCGAGA ACGGGGCGCTAGTACCACAGATATCGTGGTACTTGTTGTAGCCGCAGATGACGGTATCATGCCCCAAACTAAGGA AGTGATTAACCTTCTCAAAAAAGACACTGGTAATGTTGGTCACGTCGTTGCTATTAACAAGATCGACAAGCCGGA TGCCAATGCTGCAAGTATCATCCATTTTTAGTGGCATCCTTTTGAAGCTAAAAATATGGTTGTCCAGGAAGCTGT CAAATTGGCGCTGATGGCGGAAGGCATTCAGCTGGAATCGTTTGGCGGTGATGTGCCTTCTGTGGAGGTATCCGG TTTGACAGGCAAGGGCCTTCCAGAGCTCGTAGAAACATTAGCAGCGATGGCGGAAGTGCAGGACCTCCGCGCCGA AAAGGAGGGTGCTGTTCACGGTTATGTGCTGGAGTCAAGGGTAACAAAGGGATTAGGGTGAGTAGTCCAATTTCG TTTGATGGTACGAAACCTGAGTTCCTTTCAGTCCTGTCGCCACAATTCTGGTGTTGCGAGGATCCCTCAAAACAG GCTCTCATTGTTTAAGTGGCGCTCACATGGCCAAAGTCCGCCTCATGACTGACTCAAATGGAAAAAGTGTCAAAG TCGCAACTCCTGGTATGGCAGTTACTGTGTCGGGCTGGAAAACGCTGCCAAAGGCCGGAGATGAAGTACTTGATG GCAAAGAGTCAGATGTGAAGAAGGCGCTGGCAAATCGAGTGCGAATGGCAGGCATTGCCGCCTCGTTGGCTGACG TAGATGCTATCAATGCTACAAGGAAAGAAGAGCGGGAACGGAAAAAAGCAGAGGTTAACAAGACCGATAATCATA TCGATCCTGTTGCAGAGGCTGACGGCCCTAAAGAGCTGAAATTGATCATAAAAGCTGATGTGAGTGGGAGTGCGG AAGCAATTGAAGGGGCATTGCAAGGCATTGGAAACAAGGAGGCTATGACAAAAATTGTGTCTGCCGGTGTTGGAG ATGTTACAGATTCGGACGTGCTCATGGCAAAAGCTGTAAATGGTACGATCTCACAAACTTCCTCCATGCGAGTAT GTCGATTGAAGTACTATGAACAGCCACTATCGTTGCCTTCTCGGTCTCAGTTCCCCGCTCGGTGCAGAGTGCGGC AGCGCAAAATGCTGTGCCTATAACTGAGTCTCCGATTATTTACCATTTAATGGAGGACGTTCGTAAAAGAGTGGC TGCGCTTCTACCTACAATCACAGAGACAACAGTGACTGGTGAAGCATCGGTTCTCCAGTTGTTCGACATTCATCT CAAGGCCAAAGAAGTGAAAAAGATTGCTGGCTGTCGCGTGGTCAATGGTCTGATTGAGAAGGCTAAATTTGCACG AATCGTTAGAGACGGTTCCGTCATACACGATGGTATGTTCTTTTTTCAATTTTGATGTTGTCTATATGGCTCAAT GATTATTTCAGGATCCTTGGACACCATGCGCGTCCTCAAGAAAGATGTGACTGAGGTGCGAAAAGGCTCAGAGTG TGGCTTGAGCTTCGTAAATTTTGCGGATCTTCGCGAAGGCGATTTAATTCAGATGTACCAGACCATAGAAAAACC TGGGGTTTTGTAA |