Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058390
Gene name
Locationscaffold_3:1382232..1383104
Strand+
Gene length (bp)872
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04750 Far-17a_AIG1 FAR-17a/AIG1-like protein 1.0E-31 15 218

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96WV4|YHU5_SCHPO UPF0641 membrane protein PJ4664.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.05 PE=3 SV=2 7 189 4.0E-11

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 42 64 22
3 77 99 22
4 119 141 22
5 154 173 19
6 193 215 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058390
MTIPRLLLHAGGAGTIFYAYNAIQGLQIHEVMASQYGGSWQYLTIQGIHLAELTLWISLILDFYPSARVLKLIKR
SLLILSLPLNIVIASIYWPLILFFPAALLPEAAGTPASDAMVDMLVYLPLHLDLAMHAVPAVALAVDFFIYEQKF
GRKSTILAPLLAFAYAIFYGSWVEHCSSKNNGVFPYPFLTDNTFNGRLAIYAGAASAAPLVFWFLNGIHV*
Coding >AgabiH97|058390
ATGACAATTCCTAGGCTGCTGCTGCATGCTGGAGGTGCTGGAACTATTTTCTATGCATATAACGCCATCCAGGGA
CTGCAAATACACGAAGTGATGGCCAGCCAGTATGGTGGATCCTGGCAGTATCTAACTATACAGGGAATCCATCTC
GCAGAGTTAACTTTGTGGATTAGTCTGATCCTCGACTTTTACCCGTCCGCACGAGTCCTGAAGTTGATCAAGCGA
TCGTTACTCATTTTAAGCTTACCGCTGAACATTGTCATTGCATCAATCTACTGGCCTCTCATTTTGTTTTTTCCT
GCTGCTCTGTTGCCAGAAGCAGCGGGTACCCCTGCATCCGATGCCATGGTTGACATGCTCGTGTATCTCCCTTTG
CACCTAGATCTAGCTATGCACGCTGTACCCGCCGTTGCCCTCGCGGTGGACTTTTTTATATACGAGCAGAAATTT
GGAAGGAAATCAACAATCTTGGCACCTCTCCTCGCGTTTGCATATGCAATCTTTTATGGCAGTTGGGTGGAACAT
TGTAGCTCTAAGAACAACGGAGTTTTCCCATACCCGTTCCTCACGGATAATACTTTCAACGGTCGTTTGGCAATT
TATGCAGGAGCTGCTTCTGCTGCGCCTCTGGTGTTTTGGTTTCTCAATGGCATCCATGTCTGA
Transcript >AgabiH97|058390
ATGACAATTCCTAGGCTGCTGCTGCATGCTGGAGGTGCTGGAACTATTTTCTATGCATATAACGCCATCCAGGGA
CTGCAAATACACGAAGTGATGGCCAGCCAGTATGGTGGATCCTGGCAGTATCTAACTATACAGGGAATCCATCTC
GCAGAGTTAACTTTGTGGATTAGTCTGATCCTCGACTTTTACCCGTCCGCACGAGTCCTGAAGTTGATCAAGCGA
TCGTTACTCATTTTAAGCTTACCGCTGAACATTGTCATTGCATCAATCTACTGGCCTCTCATTTTGTTTTTTCCT
GCTGCTCTGTTGCCAGAAGCAGCGGGTACCCCTGCATCCGATGCCATGGTTGACATGCTCGTGTATCTCCCTTTG
CACCTAGATCTAGCTATGCACGCTGTACCCGCCGTTGCCCTCGCGGTGGACTTTTTTATATACGAGCAGAAATTT
GGAAGGAAATCAACAATCTTGGCACCTCTCCTCGCGTTTGCATATGCAATCTTTTATGGCAGTTGGGTGGAACAT
TGTAGCTCTAAGAACAACGGAGTTTTCCCATACCCGTTCCTCACGGATAATACTTTCAACGGTCGTTTGGCAATT
TATGCAGGAGCTGCTTCTGCTGCGCCTCTGGTGTTTTGGTTTCTCAATGGCATCCATGTCTGA
Gene >AgabiH97|058390
ATGACAATTCCTAGGCTGCTGCTGCATGCTGGAGGTGCTGGAACTATTTTCTATGCATATAACGCCATCCAGGGA
CTGCAAATACACGAAGTGATGGCCAGCCAGTATGGTGGATCCTGGCAGTATCTAACTATACAGGGGTACGTTTGC
TTCTAATGTCACAAGAAGCATGCCAAAATCGATGAGAAGAATCCATCTCGCAGAGTTAACTTTGTGGATTAGTCT
GATCCTCGACTTTTACCCGTCCGCACGAGGTGAGTGACGTATCTTCTTTGTGACGCACAAGTATTGACTTCCGCT
AGTCCTGAAGTTGATCAAGCGATCGTTACTCATTTTAAGCTTACCGGTGAGCAGTCAAAGTACCGGAACCTGTAT
CTCTCCAGGCTCATACGAATGTATAATTCAGCTGAACATTGTCATTGCATCAATCTACTGGCCTCTCATTTTGTT
TTTTCCTGCTGCTCTGTTGCCAGAAGCAGCGGGTACCCCTGCATCCGATGCCATGGTTGACATGCTCGTGTATCT
CCCTTTGCACCTAGATCTAGCTATGCACGCTGTACCCGCCGTTGCCCTCGCGGTGGACTTTTTTATATACGAGCA
GAAATTTGGAAGGAAATCAACAATCTTGGCACCTCTCCTCGCGTTTGCATATGCAATCTTTTATGGCAGTTGGGT
GGAACATTGTAGCTCTAAGAACAACGGAGTTTGTGGGTGGTTCTATCATGCAGTGCCCGATATTATGCTCATAAT
TGGCTCAAGTCCCATACCCGTTCCTCACGGATAATACTTTCAACGGTCGTTTGGCAATTTATGCAGGAGCTGCTT
CTGCTGCGCCTCTGGTGTTTTGGTTTCTCAATGGCATCCATGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail