Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058240
Gene name
Locationscaffold_3:1350519..1351400
Strand-
Gene length (bp)881
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20434 BD-FAE BD-FAE 2.9E-13 22 229
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 7.4E-09 37 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 36 231 9.0E-12
sp|A7TJ85|KFA_VANPO Kynurenine formamidase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BNA7 PE=3 SV=1 36 243 7.0E-10
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 30 233 2.0E-08
sp|Q5Z9I2|IMCL1_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Oryza sativa subsp. japonica GN=IMCEL1 PE=2 SV=1 17 243 3.0E-08
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 36 226 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 36 231 9.0E-12
sp|A7TJ85|KFA_VANPO Kynurenine formamidase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BNA7 PE=3 SV=1 36 243 7.0E-10
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 30 233 2.0E-08
sp|Q5Z9I2|IMCL1_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Oryza sativa subsp. japonica GN=IMCEL1 PE=2 SV=1 17 243 3.0E-08
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 36 226 1.0E-07
sp|Q59ZV4|KFA_CANAL Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1 29 233 4.0E-07
sp|Q6L5F5|IMCE_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Oryza sativa subsp. japonica GN=IMCE PE=2 SV=1 17 138 6.0E-07
sp|Q8K4H1|KFA_MOUSE Kynurenine formamidase OS=Mus musculus GN=Afmid PE=1 SV=1 2 170 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058240
MRVDLNIPYIPDSRRDPFREFDLYLPSDASTTGTLVCFIHGGAWRTEDKKDHAVLAEKLVRHTGLAVAVPNYRLT
LDMQDPPVRHPLHAKDILQFLEFLLTRVGPSGMGRAVDPTKLFLMGHSCSAHMLSSIFLDSSAVTPVLTPSSALL
HAVQGIVFSEGIYDLDLLCSRFPSYLDWFVAAAFEKLETYAAFTVTNHALRRPNIRWLLIHSQGDTLIDKPQTEK
MLKHLKDQYGTSADEYIHYDTSLIQGHDAILVEDEFVQIVGRFIQKSLI*
Coding >AgabiH97|058240
ATGCGTGTCGATCTAAATATTCCCTATATCCCCGATTCCCGCCGCGATCCTTTTCGCGAGTTCGATCTGTATCTT
CCATCGGATGCCTCTACCACGGGAACACTAGTTTGTTTTATCCATGGCGGCGCGTGGCGTACAGAGGACAAGAAA
GACCACGCTGTTCTGGCTGAAAAGCTTGTCCGCCACACAGGACTTGCTGTTGCGGTCCCCAATTACAGACTGACC
CTGGATATGCAAGATCCCCCCGTCCGGCATCCTTTGCATGCCAAAGATATTCTACAATTCTTAGAATTCCTCCTT
ACCCGGGTTGGACCTTCGGGCATGGGTCGCGCAGTTGATCCTACCAAGCTATTCTTGATGGGACATAGTTGCAGT
GCGCATATGCTTTCATCAATATTCTTGGATTCTTCCGCAGTCACCCCTGTCCTTACCCCGTCCTCGGCACTGCTG
CATGCTGTCCAGGGGATAGTCTTTTCCGAAGGTATCTACGACTTGGATCTCCTTTGCTCTCGTTTTCCTTCATAC
TTGGACTGGTTTGTCGCGGCCGCGTTCGAGAAATTGGAGACATACGCCGCGTTTACTGTGACAAATCACGCATTA
CGGCGGCCTAATATTCGCTGGCTGCTGATTCACTCTCAGGGAGACACACTTATCGATAAACCTCAGACGGAGAAA
ATGTTGAAACACTTGAAGGATCAATACGGTACCTCTGCTGATGAATATATCCATTACGATACGTCTCTGATACAG
GGTCACGACGCGATTCTCGTCGAGGACGAGTTTGTTCAGATCGTAGGACGTTTCATCCAGAAGTCTTTAATTTAG
Transcript >AgabiH97|058240
ATGCGTGTCGATCTAAATATTCCCTATATCCCCGATTCCCGCCGCGATCCTTTTCGCGAGTTCGATCTGTATCTT
CCATCGGATGCCTCTACCACGGGAACACTAGTTTGTTTTATCCATGGCGGCGCGTGGCGTACAGAGGACAAGAAA
GACCACGCTGTTCTGGCTGAAAAGCTTGTCCGCCACACAGGACTTGCTGTTGCGGTCCCCAATTACAGACTGACC
CTGGATATGCAAGATCCCCCCGTCCGGCATCCTTTGCATGCCAAAGATATTCTACAATTCTTAGAATTCCTCCTT
ACCCGGGTTGGACCTTCGGGCATGGGTCGCGCAGTTGATCCTACCAAGCTATTCTTGATGGGACATAGTTGCAGT
GCGCATATGCTTTCATCAATATTCTTGGATTCTTCCGCAGTCACCCCTGTCCTTACCCCGTCCTCGGCACTGCTG
CATGCTGTCCAGGGGATAGTCTTTTCCGAAGGTATCTACGACTTGGATCTCCTTTGCTCTCGTTTTCCTTCATAC
TTGGACTGGTTTGTCGCGGCCGCGTTCGAGAAATTGGAGACATACGCCGCGTTTACTGTGACAAATCACGCATTA
CGGCGGCCTAATATTCGCTGGCTGCTGATTCACTCTCAGGGAGACACACTTATCGATAAACCTCAGACGGAGAAA
ATGTTGAAACACTTGAAGGATCAATACGGTACCTCTGCTGATGAATATATCCATTACGATACGTCTCTGATACAG
GGTCACGACGCGATTCTCGTCGAGGACGAGTTTGTTCAGATCGTAGGACGTTTCATCCAGAAGTCTTTAATTTAG
Gene >AgabiH97|058240
ATGCGTGTCGATCTAAATATTCCCTATATCCCCGATTCCCGCCGCGATCCTTTTCGCGAGTTCGATCTGTATCTT
CCATCGGATGCCTCTACCACGGGAACACTAGTTTGTTTTATCCATGGCGGCGCGTGGCGTACGTAAGTCACTAGC
TTAGCTCCATTTATAGCTATTAGACAGCTGATTTCCGTCTTAGAGAGGACAAGAAAGACCACGCTGTTCTGGCTG
AAAAGCTTGTCCGCCACACAGGACTTGCTGTTGCGGTCCCCAATTACAGACTGACCCTGGATATGCAAGATCCCC
CCGTCCGGCATCCTTTGCATGCCAAAGATATTCTACAATTCTTAGAATTCCTCCTTACCCGGGTTGGACCTTCGG
GCATGGGTCGCGCAGTTGATCCTACCAAGCTATTCTTGATGGGACATAGTTGCAGTGCGCATATGCTTTCATCAA
TATTCTTGGATTCTTCCGCAGTCACCCCTGTCCTTACCCCGTCCTCGGCACTGCTGCATGCTGTCCAGGGGATAG
TCTTTTCCGAAGGTATCTACGACTTGGATCTCCTTTGCTCTCGTTTTCCTTCATACTTGGACTGGTTTGTCGCGG
CCGCGTTCGAGAAATTGGAGACATACGCCGCGTTTACTGTGACAAATCACGCATTACGGCGGCCTAATATTCGCT
GGCTGCTGATTCACTCTCAGGGAGACACACTTATCGATAAACCTCAGACGGAGAAAATGTTGAAACACTTGAAGG
ATCAATACGGTACCTCTGCTGATGAATATATCCATTACGATACGTCTCTGATACAGGGTCACGACGCGATTCTCG
TCGAGGACGAGTTTGTTCAGATCGTAGGACGTTTCATCCAGAAGTCTTTAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail