Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|058200
Gene name
Locationscaffold_3:1342720..1344593
Strand-
Gene length (bp)1873
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07915 PRKCSH Glucosidase II beta subunit-like protein 6.9E-14 152 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 1 322 1.0E-41
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 1 315 2.0E-38
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 2 348 4.0E-35
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 13 315 1.0E-26
sp|Q6C3U1|OS9_YARLI Protein OS-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOS9 PE=3 SV=1 39 320 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEA7|OS9_GIBZE Protein OS-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YOS1 PE=3 SV=1 1 322 1.0E-41
sp|Q4WCG2|OS9_ASPFU Protein OS-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yos9 PE=3 SV=1 1 315 2.0E-38
sp|Q5BDB9|OS9_EMENI Protein OS-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yos9 PE=3 SV=1 2 348 4.0E-35
sp|Q872S3|OS9_NEUCR Protein OS-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yos-9 PE=3 SV=1 13 315 1.0E-26
sp|Q6C3U1|OS9_YARLI Protein OS-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOS9 PE=3 SV=1 39 320 6.0E-20
sp|Q8GWH3|OS9_ARATH Protein OS-9 homolog OS=Arabidopsis thaliana GN=OS9 PE=1 SV=1 146 314 3.0E-18
sp|Q67WM9|OS9_ORYSJ Protein OS-9 homolog OS=Oryza sativa subsp. japonica GN=OS9 PE=2 SV=1 146 321 1.0E-15
sp|Q9UTC8|OS9_SCHPO Protein OS-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos9 PE=3 SV=3 103 315 1.0E-12
sp|Q6BJ08|OS9_DEBHA Protein OS-9 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YOS9 PE=3 SV=2 111 341 2.0E-12
sp|Q13438|OS9_HUMAN Protein OS-9 OS=Homo sapiens GN=OS9 PE=1 SV=1 84 295 2.0E-12
sp|Q3MHX6|OS9_BOVIN Protein OS-9 OS=Bos taurus GN=OS9 PE=2 SV=1 146 325 3.0E-12
sp|Q99220|OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS9 PE=1 SV=1 145 312 2.0E-11
sp|Q5RKH6|OS9_RAT Protein OS-9 OS=Rattus norvegicus GN=Os9 PE=1 SV=1 84 295 5.0E-11
sp|Q8K2C7|OS9_MOUSE Protein OS-9 OS=Mus musculus GN=Os9 PE=1 SV=2 146 295 5.0E-11
sp|Q5ACR4|OS9_CANAL Protein OS-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YOS9 PE=3 SV=1 91 314 6.0E-11
sp|Q6FV52|OS9_CANGA Protein OS-9 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YOS9 PE=3 SV=1 150 332 5.0E-10
sp|Q8VEH8|ERLEC_MOUSE Endoplasmic reticulum lectin 1 OS=Mus musculus GN=Erlec1 PE=1 SV=1 97 323 1.0E-09
sp|Q28IT1|ERLEC_XENTR Endoplasmic reticulum lectin 1 OS=Xenopus tropicalis GN=erlec1 PE=2 SV=1 95 323 5.0E-09
sp|Q96DZ1|ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens GN=ERLEC1 PE=1 SV=1 97 323 3.0E-08
sp|Q5R8S4|ERLEC_PONAB Endoplasmic reticulum lectin 1 OS=Pongo abelii GN=ERLEC1 PE=2 SV=1 97 323 3.0E-08
sp|Q756T2|OS9_ASHGO Protein OS-9 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YOS9 PE=3 SV=1 216 311 3.0E-08
sp|Q8VEH8|ERLEC_MOUSE Endoplasmic reticulum lectin 1 OS=Mus musculus GN=Erlec1 PE=1 SV=1 150 292 3.0E-07
sp|Q08B78|ERLEC_XENLA Endoplasmic reticulum lectin 1 OS=Xenopus laevis GN=erlec1 PE=2 SV=1 150 292 3.0E-07
sp|Q5R8S4|ERLEC_PONAB Endoplasmic reticulum lectin 1 OS=Pongo abelii GN=ERLEC1 PE=2 SV=1 150 292 4.0E-07
sp|Q08B78|ERLEC_XENLA Endoplasmic reticulum lectin 1 OS=Xenopus laevis GN=erlec1 PE=2 SV=1 95 300 4.0E-07
sp|Q28IT1|ERLEC_XENTR Endoplasmic reticulum lectin 1 OS=Xenopus tropicalis GN=erlec1 PE=2 SV=1 150 292 1.0E-06
sp|Q96DZ1|ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens GN=ERLEC1 PE=1 SV=1 150 292 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|058200
MRRLSAHLVLALSLRAVATKLIHSLPEDIHAFPKFRVAFLNSLPVLNDTAQRWLANGLSGGELEFSDQPHGTAAR
SMSYDRKEIESGESQSRDDPSRSNNYTLEFLKLGPKDSYVCLVPKPLDNVSSPPQEDPSDAELTPVRSWALLKPL
TGTCLYHQHGWFTYSYCHNNEIRQFKELIPQKPRLTGSYVPEEDPEWESYTLGRAPTQPAPGADLTVAELNAQAA
NLELAKTAGSRYLVQRWGDGTLCDKTGQPREVEVQFHCSMTTTDSILFVKETKTCSYVLVINTPRLCGEPGFKSR
RDATEEAEIRCREIVDVLPQEPLNYPVADYPIKEPQVRKPHLPAVEYVHKTTDGKEDNEMEGNYQADQRQEDIVN
DLLRQIVDTLIDQRRGGKATTPQEPTELVIELLDDDEQEEIGDKLINALRAAGYDVRGAEYAGLKDMIKGSKDKK
ENRKRRVKKSTDDMDDYARDEL*
Coding >AgabiH97|058200
ATGCGTCGTCTTTCTGCCCACCTTGTCCTCGCCCTTTCGCTCCGCGCTGTCGCTACAAAGCTCATCCATTCCCTC
CCAGAGGACATCCATGCCTTCCCCAAGTTCCGTGTCGCCTTCCTCAACTCCCTCCCCGTCCTCAACGACACCGCC
CAACGCTGGCTCGCCAACGGCTTATCGGGAGGCGAGCTAGAATTTTCCGACCAGCCTCACGGAACCGCTGCACGT
TCCATGTCCTATGACCGCAAGGAAATTGAAAGTGGAGAATCCCAAAGCAGAGACGACCCATCTCGCTCGAATAAC
TATACCCTCGAGTTTTTGAAACTTGGCCCAAAGGATTCTTATGTCTGTCTGGTACCCAAGCCTCTTGATAACGTC
TCCTCCCCTCCTCAGGAGGATCCATCTGATGCCGAATTAACACCAGTTCGGAGCTGGGCCCTCCTCAAACCTCTC
ACTGGAACTTGCTTATATCACCAACATGGCTGGTTCACATACTCATACTGCCACAATAACGAAATCCGTCAATTC
AAGGAACTTATCCCCCAAAAACCGCGGTTGACAGGTTCATATGTGCCAGAAGAAGACCCTGAGTGGGAATCCTAC
ACTTTAGGGCGCGCTCCGACACAGCCAGCGCCAGGTGCTGATCTGACGGTGGCCGAGCTAAACGCACAGGCGGCT
AATCTAGAGCTTGCCAAAACGGCGGGCTCACGCTACCTTGTGCAAAGATGGGGAGATGGTACACTGTGTGATAAA
ACTGGTCAACCTCGGGAAGTTGAAGTTCAGTTCCATTGTTCAATGACAACGACAGATAGCATTCTTTTCGTCAAA
GAAACAAAAACATGCTCGTATGTGCTTGTTATAAACACACCACGCCTCTGCGGTGAGCCTGGATTTAAATCGAGA
CGGGATGCTACAGAGGAAGCCGAAATACGTTGTCGCGAAATAGTCGATGTACTCCCTCAGGAACCCCTTAATTAT
CCGGTGGCCGACTATCCCATAAAAGAGCCACAAGTCCGGAAACCTCACCTTCCCGCGGTAGAATACGTCCACAAG
ACGACTGATGGCAAGGAAGACAACGAAATGGAGGGAAATTACCAAGCCGACCAAAGGCAGGAGGATATCGTCAAC
GACCTTCTCCGGCAGATCGTCGATACGCTAATTGATCAACGCCGCGGTGGGAAGGCTACAACCCCTCAAGAACCG
ACGGAACTTGTGATAGAACTTTTGGATGACGATGAACAGGAAGAAATTGGCGATAAGCTCATAAATGCTCTTCGC
GCTGCTGGTTACGATGTTCGGGGTGCTGAATACGCGGGTTTGAAGGATATGATAAAGGGGAGTAAAGACAAGAAG
GAAAACAGGAAGCGGAGGGTGAAAAAGTCTACGGATGACATGGATGATTATGCGAGAGACGAGCTCTGA
Transcript >AgabiH97|058200
ATGCGTCGTCTTTCTGCCCACCTTGTCCTCGCCCTTTCGCTCCGCGCTGTCGCTACAAAGCTCATCCATTCCCTC
CCAGAGGACATCCATGCCTTCCCCAAGTTCCGTGTCGCCTTCCTCAACTCCCTCCCCGTCCTCAACGACACCGCC
CAACGCTGGCTCGCCAACGGCTTATCGGGAGGCGAGCTAGAATTTTCCGACCAGCCTCACGGAACCGCTGCACGT
TCCATGTCCTATGACCGCAAGGAAATTGAAAGTGGAGAATCCCAAAGCAGAGACGACCCATCTCGCTCGAATAAC
TATACCCTCGAGTTTTTGAAACTTGGCCCAAAGGATTCTTATGTCTGTCTGGTACCCAAGCCTCTTGATAACGTC
TCCTCCCCTCCTCAGGAGGATCCATCTGATGCCGAATTAACACCAGTTCGGAGCTGGGCCCTCCTCAAACCTCTC
ACTGGAACTTGCTTATATCACCAACATGGCTGGTTCACATACTCATACTGCCACAATAACGAAATCCGTCAATTC
AAGGAACTTATCCCCCAAAAACCGCGGTTGACAGGTTCATATGTGCCAGAAGAAGACCCTGAGTGGGAATCCTAC
ACTTTAGGGCGCGCTCCGACACAGCCAGCGCCAGGTGCTGATCTGACGGTGGCCGAGCTAAACGCACAGGCGGCT
AATCTAGAGCTTGCCAAAACGGCGGGCTCACGCTACCTTGTGCAAAGATGGGGAGATGGTACACTGTGTGATAAA
ACTGGTCAACCTCGGGAAGTTGAAGTTCAGTTCCATTGTTCAATGACAACGACAGATAGCATTCTTTTCGTCAAA
GAAACAAAAACATGCTCGTATGTGCTTGTTATAAACACACCACGCCTCTGCGGTGAGCCTGGATTTAAATCGAGA
CGGGATGCTACAGAGGAAGCCGAAATACGTTGTCGCGAAATAGTCGATGTACTCCCTCAGGAACCCCTTAATTAT
CCGGTGGCCGACTATCCCATAAAAGAGCCACAAGTCCGGAAACCTCACCTTCCCGCGGTAGAATACGTCCACAAG
ACGACTGATGGCAAGGAAGACAACGAAATGGAGGGAAATTACCAAGCCGACCAAAGGCAGGAGGATATCGTCAAC
GACCTTCTCCGGCAGATCGTCGATACGCTAATTGATCAACGCCGCGGTGGGAAGGCTACAACCCCTCAAGAACCG
ACGGAACTTGTGATAGAACTTTTGGATGACGATGAACAGGAAGAAATTGGCGATAAGCTCATAAATGCTCTTCGC
GCTGCTGGTTACGATGTTCGGGGTGCTGAATACGCGGGTTTGAAGGATATGATAAAGGGGAGTAAAGACAAGAAG
GAAAACAGGAAGCGGAGGGTGAAAAAGTCTACGGATGACATGGATGATTATGCGAGAGACGAGCTCTGA
Gene >AgabiH97|058200
ATGCGTCGTCTTTCTGCCCACCTTGTCCTCGCCCTTTCGCTCCGCGCTGTCGCTACAAAGCTCATCCATTCCCTC
CCAGAGGACATCCATGCCTTCCCCAAGTTCCGTGTCGCCTTCCTCAACTCCCTCCCCGTCCTCAACGACACCGCC
CAACGCTGGCTCGCCAACGGCTTATCGGGAGGCGAGCTAGAATTTTCCGACCAGCCTCACGGAACCGCTGCACGT
TCCATGTCCTATGACCGCAAGGAAATTGAAAGTGGAGAATCCCAAAGCAGAGACGTCCGTCTTTCAAGGTCTCGC
TATGCTGGGAAAAGTCATCTTGACAGATTACTCACAGGACCCATCTCGCTCGAATAACTATACCCTCGAGTTTTT
GAAACTTGGCCCAAAGGATTCTTATGTCTGTCTGGTACCCAAGCCTCTTGATAACGTCTCCTCCCCTCCTCAGGA
GGATCCATCTGATGCCGAATTAACACCAGTTCGGAGCTGGGCCCTCCTCAAACCTCTCACTGGAACTTGCTTATA
TGTATGTAGTCATCCTTGGCCCGCATTCGGGTTCTGAGATAACCCCCAGCACCAACATGGCTGGTTCACATACTC
ATACTGCCACAATAACGAAATCCGTCAATTCAAGGAACTTATCCCCCAAAAACCGCGGTTGACAGGTCAGGAAAT
CCTTCTTCTTCTTCTCCTACATCCATTTATGTTTTAATTGCGATAATTTCTTTCATTCTTCCTATTGCCGTTAGA
CGTTTGTCACCTCGTCTAATCACATTTCCCGTCTTCCTGGTTTTTGAGCCCCATGACGACCCTTGCTTTCCGTTT
CCAAGCAGTGAACTGATGCTGAGACTTTTTATTATATATTACAGGTTCATATGTGCCAGAAGAAGACCCTGAGGT
AGATCAAATTTGTTTATTCTTCTTATTTCTGACATATAGGTCACCTGGACCCTGGGTTCGTTTTAGTGGGAATCC
TACACTTTAGGGCGCGCTCCGACACAGCCAGCGCCAGGTGCTGATCTGACGGTGGCCGAGCTAAACGCACAGGCG
GCTAATCTAGAGCTTGCCAAAACGGCGGGCTCACGCTACCTTGTGCAAAGATGGGGAGATGGTACACTGTGTGAT
AAAACTGGTCAACCTCGGGAAGTTGAAGTTCAGGTGAGATATTTTAATTCGCCCACTGTCACATGGAAGGTATCA
TATGCCCTAACTTCGTTATCTTTCTTTTGTTTAGTTCCATTGTTCAATGACAACGACAGATAGCATTCTTTTCGT
CAAAGAAACAAAAACATGCTCGTATGTGCTTGTTATAAACACACCACGCCTCTGCGGTGAGCCTGGATTTAAATC
GAGACGGGATGCTACAGAGGAAGCCGAAATACGTTGTCGCGAAATAGTCGATGTACTCCCTCAGGAACCCCTTAA
TTATCCGGTGGCCGACTATCCCATAAAAGAGCCACAAGTCCGGAAACCTCACCTTCCCGCGGTAGAATACGTCCA
CAAGACGACTGATGGCAAGGAAGACAACGAAATGGAGGGAAATTACCAAGCCGACCAAAGGCAGGAGGATATCGT
CAACGACCTTCTCCGGCAGATCGTCGATACGCTAATTGATCAACGCCGCGGTGGGAAGGCTACAACCCCTCAAGA
ACCGACGGAACTTGTGATAGAACTTTTGGATGACGATGAACAGGAAGAAATTGGCGATAAGCTCATAAATGCTCT
TCGCGCTGCTGGTTACGATGTTCGGGGTGCTGAATACGCGGGTTTGAAGGATATGATAAAGGGGAGTAAAGACAA
GAAGGAAAACAGGAAGCGGAGGGTGAAAAAGTCTACGGATGACATGGATGATTATGCGAGAGACGAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail