Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057940
Gene name
Locationscaffold_3:1279917..1281731
Strand-
Gene length (bp)1814
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08635 ox_reductase_C Putative oxidoreductase C terminal domain 2.2E-70 206 347
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 3.2E-23 50 203
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 2.0E-05 232 336

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14082|YEAH_SCHPO Uncharacterized protein UNK4.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.17 PE=4 SV=2 47 424 6.0E-121
sp|Q09745|YB64_SCHPO Uncharacterized protein C12C2.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.04 PE=4 SV=1 42 418 3.0E-112

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057940
MQSRRTSATAAVRRMSGRRGSGISSRRSSIDPTRLVPMDKVTHIGGGDDFNVVFIGAGNIMFGSDEGPWNHSFRL
EHKLGRRLKVVALIDPAIDRATAVLQKKCDSFVVSAYQDTRVYKTLDDFVKNMTPKERPRAIIIGSPPMFRGSLQ
PGRDVEMQILKHFPGVAMFVEKPIATGSYEHAQDGYVIAKMITDTKTICSVGYMLRYLKAVQLMKQVIEENNLTV
MSTIARYAAAYEAIAKADWWDKSKSGGPIIEQGTHFCDLSRYFGGEVDLESVHAHSLEWDENAGQLSQMRIDESK
IAPENRVPRATVATWKYDSGAVGSFTHVASLQGTDYSCEFEVYADGYLLKLVNPYVQPVLYVRTPDDDRERAYSF
PDDDPFFSEVSHLIDVIEDIEEDPEAAQILSSYEDAVRTYEFTWAIRSASERSRAAKLKASRDGAKAQKENQTD*
Coding >AgabiH97|057940
ATGCAGAGCCGCAGAACTTCCGCTACTGCCGCTGTTCGTCGCATGTCCGGGCGACGTGGCTCGGGGATCTCATCG
CGTCGCTCCTCGATCGACCCTACGCGGCTAGTTCCCATGGATAAAGTTACCCATATCGGGGGCGGCGACGACTTT
AATGTCGTTTTCATAGGCGCAGGCAATATTATGTTTGGTTCTGACGAAGGTCCATGGAATCACTCCTTTCGTTTG
GAGCACAAACTCGGCCGCCGCCTCAAAGTCGTAGCACTCATTGACCCTGCTATCGACCGTGCTACCGCGGTTCTC
CAGAAAAAGTGCGATTCATTTGTCGTATCGGCCTATCAGGATACGCGCGTCTACAAGACCCTTGATGACTTTGTG
AAAAATATGACCCCAAAAGAGAGGCCGCGTGCCATCATCATTGGATCTCCCCCTATGTTCCGGGGGTCTTTGCAA
CCAGGTAGAGACGTTGAAATGCAGATCCTGAAACATTTCCCTGGTGTTGCCATGTTCGTCGAGAAACCGATTGCC
ACGGGGTCGTACGAACATGCCCAGGATGGATATGTGATCGCAAAGATGATCACGGACACCAAGACCATTTGTTCT
GTCGGGTACATGCTGCGTTACCTCAAGGCTGTTCAACTCATGAAACAAGTCATTGAGGAGAACAACTTGACTGTA
ATGTCCACTATTGCCCGTTATGCCGCTGCATATGAGGCTATTGCTAAGGCAGATTGGTGGGACAAATCGAAAAGC
GGGGGCCCTATAATTGAACAAGGCACCCACTTTTGCGATCTTTCGCGTTATTTCGGTGGTGAAGTCGACCTTGAG
AGCGTCCATGCTCATTCACTCGAGTGGGATGAAAATGCTGGCCAGTTGTCGCAAATGCGTATTGATGAGAGCAAG
ATAGCCCCGGAAAATAGGGTACCGCGTGCCACTGTAGCAACCTGGAAATACGACAGTGGAGCTGTTGGAAGTTTT
ACACACGTTGCCTCTCTTCAAGGGACAGACTACAGTTGTGAATTCGAAGTCTACGCTGACGGATATCTTCTGAAA
CTTGTCAACCCTTACGTCCAACCAGTCCTCTACGTTCGAACTCCCGATGATGATCGTGAACGTGCATATTCTTTC
CCAGATGACGATCCGTTCTTCTCCGAAGTTTCTCATCTCATTGATGTAATCGAGGATATTGAAGAGGACCCTGAA
GCTGCTCAAATCCTTAGCTCGTATGAAGATGCGGTAAGGACGTATGAATTCACTTGGGCTATCCGTTCAGCTAGT
GAGCGGTCCCGGGCAGCCAAACTCAAGGCTAGCCGCGACGGAGCTAAGGCGCAAAAAGAAAATCAAACAGACTGA
Transcript >AgabiH97|057940
ATGCAGAGCCGCAGAACTTCCGCTACTGCCGCTGTTCGTCGCATGTCCGGGCGACGTGGCTCGGGGATCTCATCG
CGTCGCTCCTCGATCGACCCTACGCGGCTAGTTCCCATGGATAAAGTTACCCATATCGGGGGCGGCGACGACTTT
AATGTCGTTTTCATAGGCGCAGGCAATATTATGTTTGGTTCTGACGAAGGTCCATGGAATCACTCCTTTCGTTTG
GAGCACAAACTCGGCCGCCGCCTCAAAGTCGTAGCACTCATTGACCCTGCTATCGACCGTGCTACCGCGGTTCTC
CAGAAAAAGTGCGATTCATTTGTCGTATCGGCCTATCAGGATACGCGCGTCTACAAGACCCTTGATGACTTTGTG
AAAAATATGACCCCAAAAGAGAGGCCGCGTGCCATCATCATTGGATCTCCCCCTATGTTCCGGGGGTCTTTGCAA
CCAGGTAGAGACGTTGAAATGCAGATCCTGAAACATTTCCCTGGTGTTGCCATGTTCGTCGAGAAACCGATTGCC
ACGGGGTCGTACGAACATGCCCAGGATGGATATGTGATCGCAAAGATGATCACGGACACCAAGACCATTTGTTCT
GTCGGGTACATGCTGCGTTACCTCAAGGCTGTTCAACTCATGAAACAAGTCATTGAGGAGAACAACTTGACTGTA
ATGTCCACTATTGCCCGTTATGCCGCTGCATATGAGGCTATTGCTAAGGCAGATTGGTGGGACAAATCGAAAAGC
GGGGGCCCTATAATTGAACAAGGCACCCACTTTTGCGATCTTTCGCGTTATTTCGGTGGTGAAGTCGACCTTGAG
AGCGTCCATGCTCATTCACTCGAGTGGGATGAAAATGCTGGCCAGTTGTCGCAAATGCGTATTGATGAGAGCAAG
ATAGCCCCGGAAAATAGGGTACCGCGTGCCACTGTAGCAACCTGGAAATACGACAGTGGAGCTGTTGGAAGTTTT
ACACACGTTGCCTCTCTTCAAGGGACAGACTACAGTTGTGAATTCGAAGTCTACGCTGACGGATATCTTCTGAAA
CTTGTCAACCCTTACGTCCAACCAGTCCTCTACGTTCGAACTCCCGATGATGATCGTGAACGTGCATATTCTTTC
CCAGATGACGATCCGTTCTTCTCCGAAGTTTCTCATCTCATTGATGTAATCGAGGATATTGAAGAGGACCCTGAA
GCTGCTCAAATCCTTAGCTCGTATGAAGATGCGGTAAGGACGTATGAATTCACTTGGGCTATCCGTTCAGCTAGT
GAGCGGTCCCGGGCAGCCAAACTCAAGGCTAGCCGCGACGGAGCTAAGGCGCAAAAAGAAAATCAAACAGACTGA
Gene >AgabiH97|057940
ATGCAGGTATGTGTCCCTCCCAATCCCCCTCCTCGTGCTGTCTCCACGCCCAATTCAGAGCCGCAGAACTTCCGC
TACTGCCGCTGTTCGTCGCATGTCCGGGCGACGTGGCTCGGGGATCTCATCGCGTCGCTCCTCGATCGACCCTAC
GCGGCTAGTTCCCATGGATAAGTCAGTCCAAGCCATTGTTTCGCAATGCATTGTCTTAACCTCCTACTTGCCATA
GAGTTACCCATATCGGGGGCGGCGACGACTTTAATGTCGTTTTCATAGGCGCAGGCAATATTATGTTTGGTCCTG
CATATCGCCGCTTTATGTGCTTTCTGTTTGTTCTCATGTCATACAACAGGTTCTGACGAAGGTCCATGGAATCAC
TCCTTTCGTTTGGAGCAGTAAGTGAATTCTAGGCTCTGCATATATGCACTTTCTCAAAGTGTACCCAGCAAACTC
GGCCGCCGCCTCAAAGTCGTAGCACTCATTGACCCTGCTATCGACCGTGCTACCGCGGTTCTCCAGAAAAAGTGC
GATTCATTTGTCGTATCGGCCTATCAGGATACGCGCGTCTACAAGACCCTTGATGACTTTGTGAAAAATATGACC
CCAAAAGAGAGGCCGCGTGCCATCATCATTGGATCTCCCCCTATGTTCCGGGGGTCTTTGCAACCAGGTAGAGAC
GTTGAAATGCAGATCCTGAAACATTTCCCTGGTGTTGCCATGTTCGTCGAGAAACCGATTGCCACGGGGTCGTAC
GAACATGCCCAGGATGGATATGTGATCGCAAAGATGATCACGGACACCAAGACCATTTGTTCTGTCGGGTATGTG
ATTTTACTACCTTTTTTTTTTGGGAAAGCTTATACAAAGAATCAGGTACATGCTGCGTTACCTCAAGGCTGTTCA
ACTCATGAAACAAGTCATTGAGGAGAACAACTTGACTGTAATGTCCACTATTGCCCGTTATGCCGCTGCATATGA
GGCTATTGCTAAGGCAGATTGGTGGGACAAATCGAAAAGGTTTTCGTTCTGTTTTTGGGGTTGATTATCTCTAAA
TTTAACTTTACATCAAGCGGGGGCCCTATAATTGAACAAGGCACCCACTTTTGCGATCTTTCGCGTTATTTCGGT
GGTGAAGTCGACCTTGAGAGCGTCCATGCTCATTCACTCGAGTGGGATGAAAATGCTGGCCAGTTGTCGCAAATG
CGTATTGATGAGAGCAAGATAGCCCCGGAAAATAGGGTACCGCGTGCCACTGTAGCAACCTGGTAAGTTGAATAT
GCGGTGATTGGATATTGATTTACCCTCCCATGTAGGAAATACGACAGTGGAGCTGTTGGAAGTTTTACACACGTT
GCCTCTCTTCAAGGGACAGACTACAGTTGTGAATTCGAAGTCTACGCTGACGGATATCTTCTGAAGTATGCCCGT
CAAAGCTCCCTGCGTGTACTTGCTAACTTCGGATAGACTTGTCAACCCTTACGTCCAACCAGTCCTCTACGTTCG
AACTCCCGATGATGATCGTGAACGTGCATATTCTTTCCCAGATGACGATCCGTTCTTCTCCGAAGTTTCTCATCT
CATTGATGTAATCGAGGATATTGAAGAGGACCCTGAAGCTGCTCAAATCCTTAGCTCGTATGAAGGTGGGTGCGA
GCCACCAAATCACATGGCTAAGCAGGCTAACACATGGTGTAGATGCGGTAAGGACGTATGAATTCACTTGGGCTA
TCCGTTCAGCTAGTGAGCGGTCCCGGGCAGCCAAACTCAAGGCTAGCCGCGACGGAGCTAAGGCGCAAAAAGAAA
ATCAAACAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail