Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057930
Gene name
Locationscaffold_3:1274740..1279660
Strand+
Gene length (bp)4920
Transcript length (bp)3858
Coding sequence length (bp)3858
Protein length (aa) 1286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 9.2E-40 1040 1193
PF01249 Ribosomal_S21e Ribosomal protein S21e 7.6E-38 369 446
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 7.1E-31 151 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 486 1281 2.0E-131
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 480 1281 2.0E-124
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 480 1246 8.0E-123
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 479 1238 3.0E-93
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 766 1244 1.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 486 1281 2.0E-131
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 480 1281 2.0E-124
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 480 1246 8.0E-123
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 479 1238 3.0E-93
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 766 1244 1.0E-76
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 896 1231 8.0E-62
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 896 1231 1.0E-59
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 875 1226 2.0E-55
sp|Q9HA65|TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=1 SV=2 875 1225 1.0E-54
sp|Q3MII6|TBC25_HUMAN TBC1 domain family member 25 OS=Homo sapiens GN=TBC1D25 PE=1 SV=2 896 1169 4.0E-35
sp|Q8TBP0|TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens GN=TBC1D16 PE=2 SV=1 887 1232 4.0E-35
sp|Q2NKQ1|SGSM1_HUMAN Small G protein signaling modulator 1 OS=Homo sapiens GN=SGSM1 PE=1 SV=2 990 1210 6.0E-35
sp|Q8BPQ7|SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus GN=Sgsm1 PE=1 SV=2 1046 1210 8.0E-35
sp|A1A5B6|TBC25_MOUSE TBC1 domain family member 25 OS=Mus musculus GN=Tbc1d25 PE=1 SV=1 896 1169 1.0E-34
sp|O43147|SGSM2_HUMAN Small G protein signaling modulator 2 OS=Homo sapiens GN=SGSM2 PE=1 SV=4 990 1208 2.0E-32
sp|Q80U12|SGSM2_MOUSE Small G protein signaling modulator 2 OS=Mus musculus GN=Sgsm2 PE=1 SV=2 990 1208 3.0E-32
sp|O60066|ALKBH_SCHPO Alpha-ketoglutarate-dependent dioxygenase abh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abh1 PE=2 SV=3 2 341 1.0E-28
sp|Q13686|ALKB1_HUMAN DNA oxidative demethylase ALKBH1 OS=Homo sapiens GN=ALKBH1 PE=1 SV=2 149 348 2.0E-26
sp|Q9P844|RS21_CANAX 40S ribosomal protein S21 OS=Candida albicans GN=RPS21 PE=3 SV=1 369 449 6.0E-26
sp|Q75BL6|RS21_ASHGO 40S ribosomal protein S21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS21 PE=3 SV=1 369 449 6.0E-26
sp|P05764|RS21_SCHPO 40S ribosomal protein S21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps21 PE=1 SV=2 369 449 8.0E-26
sp|Q6CXT6|RS21_KLULA 40S ribosomal protein S21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS21 PE=1 SV=1 369 449 9.0E-26
sp|Q4WI01|RS21_ASPFU 40S ribosomal protein S21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rps21 PE=3 SV=1 369 449 1.0E-25
sp|Q9SA98|ALKBH_ARATH Alpha-ketoglutarate-dependent dioxygenase alkB OS=Arabidopsis thaliana GN=At1g11780 PE=2 SV=2 5 341 1.0E-25
sp|P0C0V8|RS21A_YEAST 40S ribosomal protein S21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS21A PE=1 SV=1 369 449 5.0E-25
sp|Q3E754|RS21B_YEAST 40S ribosomal protein S21-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS21B PE=1 SV=1 369 449 5.0E-25
sp|Q6FMF8|RS21_CANGA 40S ribosomal protein S21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS21 PE=3 SV=1 369 449 7.0E-25
sp|P0CB42|ALKB1_MOUSE DNA oxidative demethylase ALKBH1 OS=Mus musculus GN=Alkbh1 PE=1 SV=1 149 348 2.0E-24
sp|O93798|RS21_NEUCR 40S ribosomal protein S21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-7 PE=3 SV=1 369 449 4.0E-23
sp|Q6RF66|RS21_PECGU 40S ribosomal protein S21 OS=Pectinaria gouldii GN=rps-21 PE=3 SV=1 369 446 4.0E-23
sp|B4N002|RS21_DROWI 40S ribosomal protein S21 OS=Drosophila willistoni GN=RpS21 PE=3 SV=1 369 446 8.0E-23
sp|Q29KF5|RS21_DROPS 40S ribosomal protein S21 OS=Drosophila pseudoobscura pseudoobscura GN=RpS21 PE=3 SV=2 369 446 8.0E-23
sp|B4GSC0|RS21_DROPE 40S ribosomal protein S21 OS=Drosophila persimilis GN=RpS21 PE=3 SV=1 369 446 8.0E-23
sp|B3MLA8|RS21_DROAN 40S ribosomal protein S21 OS=Drosophila ananassae GN=RpS21 PE=3 SV=1 369 446 8.0E-23
sp|Q9SMI2|RS21_CYAPA 40S ribosomal protein S21 OS=Cyanophora paradoxa GN=RPS21 PE=3 SV=1 369 449 1.0E-22
sp|Q6XIR2|RS21_DROYA 40S ribosomal protein S21 OS=Drosophila yakuba GN=RpS21 PE=3 SV=1 369 446 2.0E-22
sp|B4I2S0|RS21_DROSE 40S ribosomal protein S21 OS=Drosophila sechellia GN=RpS21 PE=3 SV=1 369 446 2.0E-22
sp|O76927|RS21_DROME 40S ribosomal protein S21 OS=Drosophila melanogaster GN=RpS21 PE=1 SV=1 369 446 2.0E-22
sp|B3NA78|RS21_DROER 40S ribosomal protein S21 OS=Drosophila erecta GN=RpS21 PE=3 SV=1 369 446 2.0E-22
sp|Q962Q8|RS21_SPOFR 40S ribosomal protein S21 OS=Spodoptera frugiperda GN=RpS21 PE=3 SV=1 369 446 4.0E-22
sp|Q6PUF8|RS21_BOMMO 40S ribosomal protein S21 OS=Bombyx mori GN=RpS21 PE=3 SV=1 369 446 4.0E-22
sp|B4Q8M1|RS21_DROSI 40S ribosomal protein S21 OS=Drosophila simulans GN=RpS21 PE=3 SV=1 369 446 4.0E-22
sp|B4LQD3|RS21_DROVI 40S ribosomal protein S21 OS=Drosophila virilis GN=RpS21 PE=3 SV=2 369 446 6.0E-22
sp|B4KIE3|RS21_DROMO 40S ribosomal protein S21 OS=Drosophila mojavensis GN=RpS21 PE=3 SV=1 369 446 6.0E-22
sp|B4JZG4|RS21_DROGR 40S ribosomal protein S21 OS=Drosophila grimshawi GN=RpS21 PE=3 SV=2 369 446 6.0E-22
sp|Q54N08|ALKB_DICDI Alpha-ketoglutarate-dependent dioxygenase alkB OS=Dictyostelium discoideum GN=alkB PE=2 SV=1 34 316 9.0E-22
sp|Q6F477|RS21_PLUXY 40S ribosomal protein S21 OS=Plutella xylostella GN=RpS21 PE=3 SV=1 369 446 1.0E-21
sp|Q8I7N7|RS21_CERCA 40S ribosomal protein S21 OS=Ceratitis capitata GN=RpS21 PE=2 SV=1 369 446 1.0E-21
sp|Q4GXP3|RS21_AGRLI 40S ribosomal protein S21 OS=Agriotes lineatus GN=RpS21 PE=3 SV=1 369 446 2.0E-21
sp|Q6AZJ9|RS21_XENLA 40S ribosomal protein S21 OS=Xenopus laevis GN=rps21 PE=3 SV=1 369 446 3.0E-21
sp|Q41852|RS21_MAIZE 40S ribosomal protein S21 OS=Zea mays GN=RPS21 PE=3 SV=1 369 442 4.0E-21
sp|Q9M337|RS211_ARATH 40S ribosomal protein S21-1 OS=Arabidopsis thaliana GN=RPS21B PE=1 SV=1 369 442 4.0E-21
sp|Q4GXP2|RS21_BIPLU 40S ribosomal protein S21 OS=Biphyllus lunatus GN=RpS21 PE=3 SV=1 369 446 4.0E-21
sp|P35687|RS21_ORYSJ 40S ribosomal protein S21 OS=Oryza sativa subsp. japonica GN=RPS21 PE=3 SV=1 369 442 5.0E-21
sp|Q3E902|RS212_ARATH 40S ribosomal protein S21-2 OS=Arabidopsis thaliana GN=RPS21C PE=1 SV=2 369 442 1.0E-20
sp|Q86CT3|RS21_BRABE 40S ribosomal protein S21 OS=Branchiostoma belcheri GN=RPS21 PE=3 SV=1 369 442 1.0E-20
sp|Q7ZUG5|RS21_DANRE 40S ribosomal protein S21 OS=Danio rerio GN=rps21 PE=3 SV=1 369 440 2.0E-20
sp|Q90YQ2|RS21_ICTPU 40S ribosomal protein S21 OS=Ictalurus punctatus GN=rps21 PE=3 SV=1 369 440 2.0E-20
sp|Q8IYX1|TBC21_HUMAN TBC1 domain family member 21 OS=Homo sapiens GN=TBC1D21 PE=2 SV=1 896 1231 2.0E-20
sp|Q6DDC6|RS21_XENTR 40S ribosomal protein S21 OS=Xenopus tropicalis GN=rps21 PE=3 SV=1 369 440 3.0E-20
sp|P63221|RS21_PIG 40S ribosomal protein S21 OS=Sus scrofa GN=RPS21 PE=1 SV=1 369 446 4.0E-20
sp|P63220|RS21_HUMAN 40S ribosomal protein S21 OS=Homo sapiens GN=RPS21 PE=1 SV=1 369 446 4.0E-20
sp|Q32PB8|RS21_BOVIN 40S ribosomal protein S21 OS=Bos taurus GN=RPS21 PE=3 SV=1 369 446 4.0E-20
sp|P05765|RS21_RAT 40S ribosomal protein S21 OS=Rattus norvegicus GN=Rps21 PE=1 SV=1 369 446 6.0E-20
sp|Q9CQR2|RS21_MOUSE 40S ribosomal protein S21 OS=Mus musculus GN=Rps21 PE=1 SV=1 369 446 9.0E-20
sp|Q54BN4|RS21_DICDI 40S ribosomal protein S21 OS=Dictyostelium discoideum GN=rps21 PE=3 SV=1 377 449 1.0E-19
sp|P49197|RS21_CAEEL 40S ribosomal protein S21 OS=Caenorhabditis elegans GN=rps-21 PE=1 SV=1 369 446 1.0E-18
sp|Q4PM64|RS21_IXOSC 40S ribosomal protein S21 OS=Ixodes scapularis GN=RpS21 PE=3 SV=1 369 446 1.0E-18
sp|Q612Q9|RS21_CAEBR 40S ribosomal protein S21 OS=Caenorhabditis briggsae GN=rps21 PE=3 SV=1 369 446 5.0E-18
sp|Q4KTC0|RS21_SUBDO 40S ribosomal protein S21 OS=Suberites domuncula GN=RPS21 PE=3 SV=1 369 450 4.0E-17
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 903 1193 2.0E-14
sp|Q8R5A6|TB22A_MOUSE TBC1 domain family member 22A OS=Mus musculus GN=Tbc1d22a PE=1 SV=3 1048 1230 4.0E-14
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 1046 1193 6.0E-14
sp|Q8WUA7|TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens GN=TBC1D22A PE=1 SV=2 1048 1230 8.0E-14
sp|Q95KI1|TB22A_MACFA TBC1 domain family member 22A (Fragment) OS=Macaca fascicularis GN=TBC1D22A PE=2 SV=2 1048 1230 1.0E-13
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 1045 1208 7.0E-12
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 1050 1283 1.0E-11
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 1042 1213 2.0E-11
sp|Q08484|GYP1_YEAST GTPase-activating protein GYP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP1 PE=1 SV=1 921 1166 3.0E-11
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 1042 1213 4.0E-11
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 1033 1193 5.0E-11
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 1050 1283 5.0E-11
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 1063 1193 6.0E-11
sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens GN=TBC1D22B PE=1 SV=3 907 1193 8.0E-11
sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B OS=Macaca fascicularis GN=TBC1D22B PE=2 SV=1 907 1193 8.0E-11
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 1063 1193 1.0E-10
sp|P0CAT7|ALKB_CAUCR Alpha-ketoglutarate-dependent dioxygenase AlkB homolog OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=alkB PE=3 SV=1 225 308 1.0E-10
sp|B8GWW6|ALKB_CAUCN Alpha-ketoglutarate-dependent dioxygenase AlkB homolog OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=alkB PE=3 SV=2 225 308 1.0E-10
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 1025 1195 1.0E-10
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 480 693 2.0E-10
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 1050 1209 2.0E-10
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 1050 1220 3.0E-10
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 1042 1213 3.0E-10
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 1050 1214 4.0E-10
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 1050 1205 5.0E-10
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 1050 1258 8.0E-10
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 1025 1213 1.0E-09
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 1050 1209 1.0E-09
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 1050 1213 2.0E-09
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 1050 1192 2.0E-09
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 1050 1193 2.0E-09
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 1045 1206 2.0E-09
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 1050 1193 3.0E-09
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 1050 1194 4.0E-09
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 1050 1194 4.0E-09
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 1050 1184 5.0E-09
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 1050 1259 6.0E-09
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 1050 1221 7.0E-09
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 1050 1209 7.0E-09
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 1050 1184 9.0E-09
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 1050 1221 1.0E-08
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 1050 1205 1.0E-08
sp|P05050|ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB OS=Escherichia coli (strain K12) GN=alkB PE=1 SV=1 223 318 3.0E-08
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 1041 1185 4.0E-08
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 1046 1170 7.0E-08
sp|P37462|ALKB_SALTY Alpha-ketoglutarate-dependent dioxygenase AlkB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=alkB PE=3 SV=2 222 310 1.0E-07
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 1041 1213 1.0E-07
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 955 1235 1.0E-07
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 1050 1184 1.0E-07
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 1041 1185 2.0E-07
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 1025 1216 2.0E-07
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 1041 1257 4.0E-07
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 1048 1205 1.0E-06
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 1050 1205 1.0E-06
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 1050 1205 1.0E-06
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 1050 1205 1.0E-06
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 1042 1257 3.0E-06
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 1035 1193 5.0E-06
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 1048 1205 9.0E-06
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 1048 1205 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057930
MASAFRTAEKRFKARAQQPDLSRVVDPAHAVQIPGLVVLPAFLDHAQQRHLIRWALADHARHPNDTNLDTHYRIP
PEGIWHAHLHSLSHPDVTQPILPKATQDTAAPAPNAGPRQLINNVPASVDTLSVINATPKPPAPPSPTAQPMLPS
ALLYKLRWANIGWYYHWGIKQYDFSKGKGHIDPYMRDICRDAVEAVNWDQVFSGTESEWPDGKAEWKDWRETYEP
DAGIVNFYQEKDTLMAHVDRSEVCATSPLVSISLGNSAIFLIGGPTRDTEPTPILLRSGDVVIMSGPICRRAYHG
VPRILEGTLPNHLCREALAGVERESWAAYEDYMRTTRININFITSLPTTTFSSHQSVHRAQVPLLNVKMENDQGV
LVDLYVPRKCAATNQLITAKDHASVQISIADVDANGRALPTTTTFAFCGQIRSQGEGDDSLNRLATKAGLLRGLQ
RNRSSSDILLMVEISRPHSPRFTEEDRYRLVYSKSKVYVNPTAYARDNIPGFVALVKREAQNPTYLLAWIPETLL
NEKGSSEWDKFVKIEESPSQDSEDDDVVLIDLPIQRPESYAFSVPLTSIYSLIVQPPSLSSWYGSIGINLINGDT
LPILHFHDDESHSFTLQSPTISRAHDPAAIKTSLNSGTTTYPPPPPPDQISHVPRPPNSWGGEDLLSRLRQYAHI
LRSTLQPTLFLVDPSKADRETHTTQIFDDDAVDDILAQSSFANSHSPVPAHRRPRPLSQAAGTNLHPLQNPSVLH
RSLGSASSYNTSTPQTRMALLQSFSNITRATRHAAQNILSHPLAKPIVPHLPDPVRSLVSAPGEWEWGSWVEKGG
VGEFESARVYLARWARIVAEEGERARRREAQALPSIDADNEQETSSLGIFELLHTTANLPTPKSSRSPESPVTER
EWAAWFDAQGRPVVCVEEFKREIFRRGISGGKDLRKKVWPFLLGVFNWNSTAAERATFWREQRQQYQKIKSEWWE
VPDVFDRQDVIEERHRIDVDCRRTDRNQPLFAIPPPTPDVDASAKSKNRRPHPTVSLQSDEYGAQSPSNEHIERL
SNILLTYNFYEKELGYVQGMSDLCAPIYVVMDADEEMTFWCFVYFMERMKKNFLRDQSGMKQQLSTLQQLIEVMD
PELFRHLDKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLESHRDVILRYLVEFD
EILKYCNELSMTIELDTTLAQAEVLFLSFAQLVADIDRRKAEEVGSTRTSYMRNRSTGTNDQTKHANLGMLKLSD
ELRELLVSGA*
Coding >AgabiH97|057930
ATGGCCTCTGCCTTTCGGACTGCAGAAAAGAGATTCAAGGCCCGAGCACAGCAGCCAGATCTCTCCCGCGTCGTC
GATCCAGCTCACGCAGTACAGATACCCGGCCTCGTCGTCCTCCCCGCCTTTCTCGACCATGCCCAGCAGCGTCAT
CTGATCCGATGGGCGCTTGCCGACCACGCTAGACACCCAAACGACACCAACCTCGACACCCACTATCGCATCCCT
CCCGAGGGCATATGGCATGCCCATCTCCACTCCCTCTCTCACCCCGATGTCACCCAGCCGATTCTTCCAAAAGCA
ACTCAAGACACAGCAGCGCCTGCCCCGAATGCAGGACCGCGTCAACTCATCAACAACGTCCCCGCTTCCGTTGAT
ACACTGTCCGTCATCAATGCCACTCCCAAACCACCCGCACCGCCCTCGCCCACCGCCCAGCCCATGCTACCCTCT
GCTCTCCTCTACAAGCTGCGTTGGGCTAATATCGGATGGTACTATCACTGGGGCATCAAACAGTACGATTTCTCC
AAAGGCAAGGGCCACATAGACCCATACATGCGCGACATATGCAGAGATGCAGTAGAAGCGGTTAACTGGGACCAG
GTATTCTCTGGCACGGAGAGCGAGTGGCCAGATGGAAAGGCCGAATGGAAAGACTGGAGAGAGACGTATGAACCA
GACGCTGGGATCGTCAACTTTTACCAGGAAAAAGATACTCTCATGGCACACGTCGACCGCTCAGAGGTCTGTGCA
ACCTCACCCCTCGTCTCAATATCACTCGGAAATTCCGCTATATTTCTAATAGGTGGACCCACAAGAGACACAGAG
CCCACACCTATTCTTCTACGCTCCGGCGACGTTGTCATTATGTCCGGCCCCATCTGCCGGCGAGCTTACCATGGT
GTTCCGCGGATACTGGAGGGGACACTCCCTAATCATTTGTGTCGGGAAGCACTTGCTGGTGTTGAGAGGGAATCC
TGGGCGGCATATGAAGACTATATGCGCACAACGAGGATTAATATAAACTTTATCACTTCGCTTCCCACGACCACA
TTTTCCTCACACCAATCTGTTCACCGAGCTCAAGTCCCGCTTCTCAACGTCAAAATGGAAAACGATCAAGGTGTC
CTCGTCGATCTCTATGTTCCGCGCAAATGCGCTGCTACCAACCAACTGATTACCGCAAAAGACCATGCGTCCGTC
CAGATCAGCATTGCTGACGTCGATGCCAATGGCCGCGCCCTCCCAACCACAACAACATTTGCATTCTGTGGGCAG
ATCCGGTCACAAGGCGAGGGCGACGACTCGCTAAACAGACTCGCCACCAAGGCTGGACTGCTGCGCGGCCTGCAG
CGAAATCGGTCCTCCTCAGACATTCTCCTCATGGTCGAAATCTCCCGTCCTCATTCTCCACGGTTTACTGAGGAG
GACAGATATCGGCTCGTCTATTCAAAGTCCAAAGTCTATGTCAATCCCACCGCTTACGCTCGGGACAACATTCCT
GGCTTTGTAGCTCTAGTCAAGAGGGAAGCACAAAATCCAACCTATCTGCTGGCATGGATCCCAGAGACACTGCTC
AATGAAAAGGGAAGCTCCGAGTGGGACAAATTCGTCAAGATCGAGGAAAGTCCTTCCCAAGACAGCGAGGATGAT
GATGTCGTTCTCATTGACCTTCCTATTCAACGTCCAGAATCTTATGCCTTTTCTGTACCTCTCACATCCATATAC
TCTCTCATCGTTCAACCTCCCTCGCTCTCTTCGTGGTATGGATCTATTGGTATCAATTTAATCAATGGCGACACT
CTTCCTATACTTCACTTTCACGACGACGAATCCCACTCTTTCACTCTCCAGTCACCCACCATCTCTCGCGCTCAT
GATCCTGCTGCTATCAAGACCTCGCTTAATTCAGGAACAACAACTTATCCTCCACCCCCACCCCCAGATCAAATA
TCCCATGTTCCAAGACCACCTAATTCCTGGGGCGGCGAAGACCTTTTGTCCCGCTTACGTCAATATGCCCACATA
CTCCGCTCCACACTCCAGCCCACACTGTTCTTGGTAGATCCGTCGAAAGCCGACAGAGAAACGCATACAACTCAA
ATCTTTGATGACGATGCTGTGGATGATATACTCGCCCAGTCTTCATTCGCGAATTCCCACTCTCCCGTACCCGCC
CACAGAAGACCAAGACCGTTGTCTCAAGCTGCTGGCACGAATCTACATCCATTGCAGAATCCGTCTGTCTTGCAT
CGGTCCTTGGGATCCGCATCGTCGTATAATACTTCAACTCCTCAGACTCGTATGGCTCTACTACAGAGTTTTTCA
AATATCACGAGGGCGACTAGACACGCTGCGCAAAATATTCTTTCACATCCCTTGGCGAAACCTATAGTACCGCAC
TTGCCGGATCCTGTAAGGAGTCTTGTCAGTGCACCAGGAGAATGGGAGTGGGGAAGCTGGGTTGAAAAAGGTGGC
GTTGGAGAGTTCGAAAGTGCAAGAGTTTATCTCGCACGGTGGGCGAGGATCGTCGCAGAGGAAGGTGAACGTGCA
CGAAGACGTGAAGCTCAGGCATTACCATCGATAGATGCGGACAATGAACAAGAAACATCATCACTGGGAATATTT
GAACTCCTCCATACGACGGCGAATCTGCCTACGCCGAAGAGCTCGAGGAGCCCTGAGAGTCCTGTTACTGAAAGA
GAATGGGCGGCATGGTTTGATGCGCAGGGGAGACCTGTGGTCTGCGTAGAAGAGTTCAAGAGGGAGATATTTAGG
AGAGGCATTAGTGGGGGGAAAGATTTGAGGAAGAAGGTATGGCCATTTTTGCTTGGCGTTTTCAACTGGAATTCG
ACTGCGGCGGAGAGAGCGACTTTTTGGCGGGAACAAAGACAGCAGTATCAAAAAATCAAGAGCGAGTGGTGGGAG
GTACCAGACGTATTTGATAGACAAGACGTGATCGAGGAACGACACCGGATTGACGTGGATTGTAGACGAACAGAC
AGGAACCAACCTCTTTTCGCTATACCCCCACCAACACCGGATGTTGACGCCAGCGCAAAATCAAAGAATCGCCGG
CCGCATCCGACAGTCTCTCTACAATCAGATGAATACGGTGCTCAGTCACCGAGCAATGAACATATAGAACGTCTA
TCGAACATATTATTGACATATAATTTTTATGAAAAAGAATTGGGTTATGTGCAGGGCATGTCAGACCTTTGTGCA
CCGATCTATGTGGTAATGGATGCAGATGAGGAAATGACATTTTGGTGTTTTGTGTATTTTATGGAACGAATGAAA
AAGAATTTTTTGCGCGATCAGAGTGGAATGAAGCAACAGCTTTCGACATTACAACAACTGATAGAGGTCATGGAT
CCGGAACTCTTCCGACATCTGGATAAGACAGACGGTTTGAATCTCTTTTTCTGCTTCCGATGGGTTCTAATCGCC
TTCAAACGCGAATTCCCATTTGATGACGTGCTACGGTTATGGGAAGTGCTGTGGACGGATTACTACAGCACACAG
TTTGTGCTTTTTGTTGCGCTTGCTGTATTGGAATCCCATAGAGATGTGATTCTTCGGTACCTTGTCGAGTTTGAC
GAGATCCTAAAGTACTGCAACGAACTTAGCATGACTATTGAGCTCGACACGACCCTTGCCCAAGCTGAAGTATTG
TTCTTATCCTTCGCGCAACTGGTAGCCGATATAGATCGAAGAAAGGCTGAGGAAGTTGGATCAACAAGAACCAGT
TATATGCGAAATAGATCAACAGGGACTAACGATCAAACTAAGCATGCAAATTTGGGTATGTTGAAGCTCTCGGAC
GAGTTGAGGGAGTTGTTGGTTAGTGGAGCATGA
Transcript >AgabiH97|057930
ATGGCCTCTGCCTTTCGGACTGCAGAAAAGAGATTCAAGGCCCGAGCACAGCAGCCAGATCTCTCCCGCGTCGTC
GATCCAGCTCACGCAGTACAGATACCCGGCCTCGTCGTCCTCCCCGCCTTTCTCGACCATGCCCAGCAGCGTCAT
CTGATCCGATGGGCGCTTGCCGACCACGCTAGACACCCAAACGACACCAACCTCGACACCCACTATCGCATCCCT
CCCGAGGGCATATGGCATGCCCATCTCCACTCCCTCTCTCACCCCGATGTCACCCAGCCGATTCTTCCAAAAGCA
ACTCAAGACACAGCAGCGCCTGCCCCGAATGCAGGACCGCGTCAACTCATCAACAACGTCCCCGCTTCCGTTGAT
ACACTGTCCGTCATCAATGCCACTCCCAAACCACCCGCACCGCCCTCGCCCACCGCCCAGCCCATGCTACCCTCT
GCTCTCCTCTACAAGCTGCGTTGGGCTAATATCGGATGGTACTATCACTGGGGCATCAAACAGTACGATTTCTCC
AAAGGCAAGGGCCACATAGACCCATACATGCGCGACATATGCAGAGATGCAGTAGAAGCGGTTAACTGGGACCAG
GTATTCTCTGGCACGGAGAGCGAGTGGCCAGATGGAAAGGCCGAATGGAAAGACTGGAGAGAGACGTATGAACCA
GACGCTGGGATCGTCAACTTTTACCAGGAAAAAGATACTCTCATGGCACACGTCGACCGCTCAGAGGTCTGTGCA
ACCTCACCCCTCGTCTCAATATCACTCGGAAATTCCGCTATATTTCTAATAGGTGGACCCACAAGAGACACAGAG
CCCACACCTATTCTTCTACGCTCCGGCGACGTTGTCATTATGTCCGGCCCCATCTGCCGGCGAGCTTACCATGGT
GTTCCGCGGATACTGGAGGGGACACTCCCTAATCATTTGTGTCGGGAAGCACTTGCTGGTGTTGAGAGGGAATCC
TGGGCGGCATATGAAGACTATATGCGCACAACGAGGATTAATATAAACTTTATCACTTCGCTTCCCACGACCACA
TTTTCCTCACACCAATCTGTTCACCGAGCTCAAGTCCCGCTTCTCAACGTCAAAATGGAAAACGATCAAGGTGTC
CTCGTCGATCTCTATGTTCCGCGCAAATGCGCTGCTACCAACCAACTGATTACCGCAAAAGACCATGCGTCCGTC
CAGATCAGCATTGCTGACGTCGATGCCAATGGCCGCGCCCTCCCAACCACAACAACATTTGCATTCTGTGGGCAG
ATCCGGTCACAAGGCGAGGGCGACGACTCGCTAAACAGACTCGCCACCAAGGCTGGACTGCTGCGCGGCCTGCAG
CGAAATCGGTCCTCCTCAGACATTCTCCTCATGGTCGAAATCTCCCGTCCTCATTCTCCACGGTTTACTGAGGAG
GACAGATATCGGCTCGTCTATTCAAAGTCCAAAGTCTATGTCAATCCCACCGCTTACGCTCGGGACAACATTCCT
GGCTTTGTAGCTCTAGTCAAGAGGGAAGCACAAAATCCAACCTATCTGCTGGCATGGATCCCAGAGACACTGCTC
AATGAAAAGGGAAGCTCCGAGTGGGACAAATTCGTCAAGATCGAGGAAAGTCCTTCCCAAGACAGCGAGGATGAT
GATGTCGTTCTCATTGACCTTCCTATTCAACGTCCAGAATCTTATGCCTTTTCTGTACCTCTCACATCCATATAC
TCTCTCATCGTTCAACCTCCCTCGCTCTCTTCGTGGTATGGATCTATTGGTATCAATTTAATCAATGGCGACACT
CTTCCTATACTTCACTTTCACGACGACGAATCCCACTCTTTCACTCTCCAGTCACCCACCATCTCTCGCGCTCAT
GATCCTGCTGCTATCAAGACCTCGCTTAATTCAGGAACAACAACTTATCCTCCACCCCCACCCCCAGATCAAATA
TCCCATGTTCCAAGACCACCTAATTCCTGGGGCGGCGAAGACCTTTTGTCCCGCTTACGTCAATATGCCCACATA
CTCCGCTCCACACTCCAGCCCACACTGTTCTTGGTAGATCCGTCGAAAGCCGACAGAGAAACGCATACAACTCAA
ATCTTTGATGACGATGCTGTGGATGATATACTCGCCCAGTCTTCATTCGCGAATTCCCACTCTCCCGTACCCGCC
CACAGAAGACCAAGACCGTTGTCTCAAGCTGCTGGCACGAATCTACATCCATTGCAGAATCCGTCTGTCTTGCAT
CGGTCCTTGGGATCCGCATCGTCGTATAATACTTCAACTCCTCAGACTCGTATGGCTCTACTACAGAGTTTTTCA
AATATCACGAGGGCGACTAGACACGCTGCGCAAAATATTCTTTCACATCCCTTGGCGAAACCTATAGTACCGCAC
TTGCCGGATCCTGTAAGGAGTCTTGTCAGTGCACCAGGAGAATGGGAGTGGGGAAGCTGGGTTGAAAAAGGTGGC
GTTGGAGAGTTCGAAAGTGCAAGAGTTTATCTCGCACGGTGGGCGAGGATCGTCGCAGAGGAAGGTGAACGTGCA
CGAAGACGTGAAGCTCAGGCATTACCATCGATAGATGCGGACAATGAACAAGAAACATCATCACTGGGAATATTT
GAACTCCTCCATACGACGGCGAATCTGCCTACGCCGAAGAGCTCGAGGAGCCCTGAGAGTCCTGTTACTGAAAGA
GAATGGGCGGCATGGTTTGATGCGCAGGGGAGACCTGTGGTCTGCGTAGAAGAGTTCAAGAGGGAGATATTTAGG
AGAGGCATTAGTGGGGGGAAAGATTTGAGGAAGAAGGTATGGCCATTTTTGCTTGGCGTTTTCAACTGGAATTCG
ACTGCGGCGGAGAGAGCGACTTTTTGGCGGGAACAAAGACAGCAGTATCAAAAAATCAAGAGCGAGTGGTGGGAG
GTACCAGACGTATTTGATAGACAAGACGTGATCGAGGAACGACACCGGATTGACGTGGATTGTAGACGAACAGAC
AGGAACCAACCTCTTTTCGCTATACCCCCACCAACACCGGATGTTGACGCCAGCGCAAAATCAAAGAATCGCCGG
CCGCATCCGACAGTCTCTCTACAATCAGATGAATACGGTGCTCAGTCACCGAGCAATGAACATATAGAACGTCTA
TCGAACATATTATTGACATATAATTTTTATGAAAAAGAATTGGGTTATGTGCAGGGCATGTCAGACCTTTGTGCA
CCGATCTATGTGGTAATGGATGCAGATGAGGAAATGACATTTTGGTGTTTTGTGTATTTTATGGAACGAATGAAA
AAGAATTTTTTGCGCGATCAGAGTGGAATGAAGCAACAGCTTTCGACATTACAACAACTGATAGAGGTCATGGAT
CCGGAACTCTTCCGACATCTGGATAAGACAGACGGTTTGAATCTCTTTTTCTGCTTCCGATGGGTTCTAATCGCC
TTCAAACGCGAATTCCCATTTGATGACGTGCTACGGTTATGGGAAGTGCTGTGGACGGATTACTACAGCACACAG
TTTGTGCTTTTTGTTGCGCTTGCTGTATTGGAATCCCATAGAGATGTGATTCTTCGGTACCTTGTCGAGTTTGAC
GAGATCCTAAAGTACTGCAACGAACTTAGCATGACTATTGAGCTCGACACGACCCTTGCCCAAGCTGAAGTATTG
TTCTTATCCTTCGCGCAACTGGTAGCCGATATAGATCGAAGAAAGGCTGAGGAAGTTGGATCAACAAGAACCAGT
TATATGCGAAATAGATCAACAGGGACTAACGATCAAACTAAGCATGCAAATTTGGGTATGTTGAAGCTCTCGGAC
GAGTTGAGGGAGTTGTTGGTTAGTGGAGCATGA
Gene >AgabiH97|057930
ATGGCCTCTGCCTTTCGGACTGCAGAAAAGAGATTCAAGGCCCGAGCACAGCAGCCAGATCTCTCCCGCGTCGTC
GATCCAGCTCACGCAGTACAGATACCCGGTGCGCCGCCATTCCATCCCGCCATTCGTTCATCCGTTCATCTGCCC
AGGCCTCGTCGTCCTCCCCGCCTTTCTCGACCATGCCCAGCAGCGTCATCTGATCCGATGGGCGCTTGCCGACCA
CGCTAGACACCCAAACGACACCAACCTCGACACCCACTATCGCATCCCTCCCGAGGGCATATGGCATGCCCATCT
CCACTCCCTCTCTCACCCCGATGTCACCCAGCCGATTCTTCCAAAAGCAACTCAAGACACAGCAGCGCCTGCCCC
GAATGCAGGACCGCGTCAACTCATCAACAACGTCCCCGCTTCCGTTGATACACTGTCCGTCATCAATGCCACTCC
CAAACCACCCGCACCGCCCTCGCCCACCGCCCAGCCCATGCTACCCTCTGCTCTCCTCTACAAGCTGCGTTGGGC
TAATATCGGATGGTACTATCACTGGGGCATCAAACAGTACGATTTCTCCAAAGGCAAGGGCCACATAGACCCATA
CATGCGCGACATATGCAGAGATGCAGTAGAAGCGGTTAACTGGGACCAGGTATTCTCTGGCACGGAGAGCGAGTG
GCCAGATGGAAAGGCCGAATGGAAAGACTGGAGAGAGACGTATGGTACGTTTGCTTCTCAACCGGGCCGGTCATT
TAAGCTCATCCAGTGCAGAACCAGACGCTGGGATCGTCAACTTTTACCAGGAAAAAGATACTCTCATGGCACACG
TCGACCGCTCAGAGGTCTGTGCAACCTCACCCCTCGTCTCAATATCGTACGTCTTTTACAAACTCTCTTGCCGTG
CCATAATTGAGATCTTTCCAGACTCGGAAATTCCGCTATATTTCTAATAGGTGGACCCACAAGAGACACAGAGCC
CACACCTATTCTTCTACGCTCCGGCGACGTTGTCATTATGTCCGGCCCCATCTGCCGGCGAGCTTACCATGGTGA
GTCGCACTTGTTTGCTGACGATGAGATTACCAATTTAACTAGGTGTTCCGCGGATACTGGAGGGGACACTCCCTA
ATCATTTGTGTCGGGAAGCACTTGCTGGTGTTGAGAGGGAATCCTGGGCGGCATATGAAGACTATATGCGCACAA
CGAGGATTAATATAAACGTCAGACAAGTCTTTCCGAAAGGCTTTGATGGATTATCTTAGATCTTATCTTATCATA
AGCGCAAACAACTGTACAGTTTATCACTTCGCTTCCCACGACCACATTTTCCTCACACCAATCTGTTCACCGAGC
TCAAGTCCCGCTTCTCAACGTCAAAATGGAAAACGATCAAGTACGTCCCCACTTTGCTCACCGGAATACTAGATA
ACTGACCGTGTCGTTCAGGGTGTCCTCGTCGATCTCTATGTTCCGCGCAAATGCGCTGCTACCAGTGCGGTCAAC
TCTATCTATGGGATAGCTAACGCTGACTGTGTGCCAGACCAACTGATTACCGCAAAAGACCATGCGTCCGTCCAG
ATCAGCATTGCTGACGTCGATGCCAATGGCCGCGCCCTCCCAACCACAACAACATTTGCATTCTGTGGGCAGATC
CGGTCACAAGGCGAGGGCGACGACTCGCTAAACAGACTCGCCACCAAGGCTGGACGTGAGTTGCTTTGTGGACTT
ATCGAGTCATTGCTGACGTTGGATCAGTGCTGCGCGGCGTATGGTCGTACCAAAAGTAACTAGCTACATTAGTTG
TGTATTAGTGTCACGTGCAAAGACATTTCATGTGCGCAGCTGCAGCGAAATCGGTCCTCCTCAGACATTCTCCTC
ATGGTCGAAATCTCCCGTCCTCATTCTCCACGGTTTACTGAGGAGGACAGATATCGGCTCGTCTATTCAAAGTCC
AAAGTCTATGTCAATCCCACCGCTTACGCTCGGGACAACATTCCTGGCTTTGTAGCTCTAGTCAAGAGGGTGTGT
GATGCCCGTACGAGTCCCAGCTTGCTCTCATAGAACCGTAGGAAGCACAAAATCCAACCTATCTGCTGGCATGGA
TCCCAGAGACACTGCTCAATGAAAAGGGAAGCTCCGAGTGGGACAAATTCGTCAAGATCGAGGAAAGTCCTTCCC
AAGACAGCGAGGATGATGGTGTCTACTCATTTCTTTGTTCTCTCTATCCTGTTAGTACTGAACACCCGTCTCAAC
AGATGTCGTTCTCATTGACCTTCCTATTCAACGTCCAGAATCTTATGCCTTTTCTGTACCTCTCACATCCATATA
CTCTCTCATCGTTCAACCTCCCTCGCTCTCTTCGTGGTGTATGTTTTCTATTCATTAGAGAATTACTTTCTCTCA
AAATTGCTATGCAGATGGATCTATTGGTATCAATTTAATCAATGGCGACACTCTTCCTATACTTCACTTTCACGA
CGACGAATCCCACTCTTTCACTCTCCAGTCACCCACCATCTCTCGCGCTCATGATCCTGCTGCTATCAAGACCTC
GCTTAATTCAGGAACAACAACTTATCCTCCACCCCCACCCCCAGATCAAATATCCCATGTTCCAAGACCACCTAA
TTCCTGGGGCGGCGAAGACCTTTTGTCCCGCTTACGTCAATATGCCCACATACTCCGCTCCACACTCCAGCCCAC
ACTGTTCTTGGTAGATCCGTCGAAAGCCGACAGAGAAACGCATACAACTCAAATCTTTGATGACGATGCTGTGGA
TGATATACTCGCCCAGTCTTCATTCGCGAATTCCCACTCTCCCGTACCCGCCCACAGAAGACCAAGACCGTTGTC
TCAAGCTGCTGGCACGAATCTACATCCATTGCAGAATCCGTCTGTCTTGCATCGGTCCTTGGGATCCGCATCGTC
GTATAATACTTCAACTCCTCAGACTCGTATGGCTCTACTACAGAGTTTTTCAAATATCACGAGGGCGACTAGACA
CGCTGCGCAAAATATTCTTTCACATCCCTTGGCGAAACCTATAGTACCGCACTTGCCGGATCCTGTAAGGAGTCT
TGTCAGTGCACCAGGAGAATGGGAGTGGGGAAGCTGGGTTGAAAAAGGTGGCGTTGGAGAGTTCGAAAGTGCAAG
AGTTTATCTCGCACGGTGGGCGAGGATCGTCGCAGAGGAAGGTGAACGTGCACGAAGACGTGAAGCTCAGGCATT
ACCATCGATAGATGCGGACAATGAACAAGAAACATCATCACTGGGAATATTTGAACTCCTCCATACGACGGCGAA
TCTGCCTACGCCGAAGAGCTCGAGGAGCCCTGAGAGTCCTGTTACTGAAAGAGAATGGGCGGCATGGTTTGATGC
GCAGGGGAGACCTGTGGTCTGCGTAGAAGAGTTCAAGAGGGAGATATTTAGGAGAGGCATTAGTGGGGGGAAAGA
TTTGAGGAAGAAGGTATGGCCATTTTTGCTTGGCGTTTTCAACTGGAATTCGACTGCGGCGGAGAGAGCGACTTT
TTGGCGGGAACAAAGGTATGCCAAGCTGATGCTAACATTCTAAAATGCATATCTCACCGAGTTTGCTAGACAGCA
GTATCAAAAAATCAAGAGCGAGTGGTGGGAGGTACCAGACGTATTTGATAGACAAGACGTGATCGAGGAACGACA
CCGGATTGACGTGGATTGTAGACGAACAGACAGGAACCAACCTCTTTTCGCTATACCCCCACCAACACCGGATGT
TGACGCCAGCGCAAAATCAAAGAATCGCCGGCCGCATCCGACAGTCTCTCTACAATCAGATGAATACGGTGCTCA
GTCACCGAGCAATGAACATATAGAACGTCTATCGAACATATTATTGACATATAATTTTTATGAAAAAGAATTGGG
TACGTTTGTGAGCTCGTTCTATATCTTGAATTTGCCTGACCGCATGAGGCTTTTTTTTCGAAGGTTATGTGCAGG
GCATGTCAGACCTTTGTGCACCGATCTATGTGGTAATGGATGCAGATGAGGAAATGACATTTTGGTGTTTTGTGT
ATTTTATGGAACGAATGGTACGATCGTGGACTTGTTAAACCAACAGCAGGCTGATCTTGGTTGTAGAAAAAGAAT
TTTTTGCGCGATCAGAGTGGAATGAAGCAACAGCTTTCGACATTACAACAACTGATAGAGGTCATGGATCCGGAA
CTCTTCCGACATCTGGGTAGGTCGCATCTCTACCTTTCAAATATGCTTTATCACCTTATCAATATTCTCTAGATA
AGACAGACGGTTTGAATCTCTTTTTCTGCTTCCGGTATGTCCAATTGACTCTTTCTTCTGTATATGTTGAATGGC
TGACATTATCTTGAAGATGGGTTCTAATCGCCTTCAAACGCGAATTCCCATTTGATGACGTGCTACGGTTATGGG
AAGTGCTGTGGACGGATTACTACAGCACACAGTTTGTGCTTTTTGTTGCGCTTGCTGTATTGGAATCCCATAGAG
ATGTGATTCTTCGGTACCTTGTCGAGGTATGTTTCCATCCTGACTTTTTCTTTTCTTTTTCATTGCTAATCACGG
CTTATCACATTATTACTATCCTCAAGTTTGACGAGATCCTAAAGGTGTGTCACCCTATTTTTCGAGTCGAATCAT
CAGGCTAAAATTCAGATGTGATAGTACTGCAACGAACTTAGCATGACTATTGAGCTCGACACGACCCTTGCCCAA
GCTGAAGTATTGTTCTTATCCTTCGCGCAACTGGTAGCCGATATAGATCGAAGAAAGGCTGAGGAAGTTGGATCA
ACAAGAACCAGTTATATGCGAAATAGATCAACAGGGACTAACGATCAAACTAAGCATGCAAATTTGGGTATGTTG
AAGCTCTCGGACGAGTTGAGGGAGTTGTTGGTTAGTGGAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail