Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057830
Gene name
Locationscaffold_3:1257090..1257722
Strand+
Gene length (bp)632
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 9.5E-10 3 68

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08558|DCI1_YEAST Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCI1 PE=1 SV=1 4 135 1.0E-11
sp|Q05871|ECI1_YEAST 3,2-trans-enoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECI1 PE=1 SV=1 4 135 2.0E-11
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 3 116 1.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 3 116 1.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 3 116 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08558|DCI1_YEAST Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCI1 PE=1 SV=1 4 135 1.0E-11
sp|Q05871|ECI1_YEAST 3,2-trans-enoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECI1 PE=1 SV=1 4 135 2.0E-11
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 3 116 1.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 3 116 1.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 3 116 1.0E-07
sp|Q78JN3|ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus GN=Eci3 PE=1 SV=1 3 113 3.0E-07
sp|Q9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1 3 116 6.0E-07
sp|Q8N8U2|CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens GN=CDYL2 PE=1 SV=2 3 116 1.0E-06
sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 3 106 3.0E-06
sp|Q6AYK9|CDYL_RAT Chromodomain Y-like protein OS=Rattus norvegicus GN=Cdyl PE=1 SV=1 3 109 4.0E-06
sp|Q9D5D8|CDYL2_MOUSE Chromodomain Y-like protein 2 OS=Mus musculus GN=Cdyl2 PE=1 SV=1 3 116 5.0E-06
sp|Q9WTK2|CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus GN=Cdyl PE=1 SV=1 3 106 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 83.98 43.19 124.76
Initials Initials knots 93.42 48.68 138.16
Pileal_Stipeal_center Stage I stipe center 88.62 45.78 131.46
Pileal_Stipeal_shell Stage I stipe shell 110.33 58.53 162.12
DIF_stipe_center Stage II stipe center 88.06 45.63 130.50
DIF_stipe_shell Stage II stipe shell 58.63 28.70 88.55
DIF_stipe_skin Stage II stipe skin 79.03 40.22 117.83
DIF_cap_skin Stage II cap skin 157.56 86.35 228.76
DIF_cap_tissue Stage II cap tissue 169.28 91.14 247.42
DIF_gill_tissue Stage II gill tissue 108.43 57.45 159.41
YFB_stipe_center Young fruiting body stipe center 93.67 48.90 138.44
YFB_stipe_shell Young fruiting body stipe shell 77.44 39.46 115.42
YFB_stipe_skin Young fruiting body stipe skin 70.47 35.44 105.50
YFB_cap_skin Young fruiting body cap skin 159.36 88.17 230.55
YFB_cap_tissue Young fruiting body cap tissue 172.25 96.60 247.89
YFB_gill_tissue Young fruiting body gill tissue 110.00 58.26 161.75
YFB_veil Young fruiting body veil 91.35 46.54 136.17

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.549091 no
Casing YFB_stipe_center 0.841964 no
Casing YFB_stipe_shell 0.892377 no
Casing YFB_stipe_skin 0.730460 no
Casing YFB_cap_skin 0.041603 yes
Casing YFB_cap_tissue 0.020790 yes
Casing YFB_gill_tissue 0.519406 no
Casing YFB_veil 0.888742 no
Casing Initials 0.848613 no
Casing Pileal_Stipeal_center 0.931642 no
Casing Pileal_Stipeal_shell 0.514373 no
Casing DIF_stipe_center 0.940693 no
Casing DIF_stipe_shell 0.365235 no
Casing DIF_stipe_skin 0.922664 no
Casing DIF_cap_skin 0.043772 yes
Casing DIF_cap_tissue 0.025963 yes
DIF_gill_tissue YFB_stipe_center 0.772199 no
DIF_gill_tissue YFB_stipe_shell 0.394341 no
DIF_gill_tissue YFB_stipe_skin 0.246295 no
DIF_gill_tissue YFB_cap_skin 0.278783 no
DIF_gill_tissue YFB_cap_tissue 0.158092 no
DIF_gill_tissue YFB_gill_tissue 0.982104 no
DIF_gill_tissue YFB_veil 0.730008 no
YFB_stipe_center YFB_stipe_shell 0.693652 no
YFB_stipe_center YFB_stipe_skin 0.498713 no
YFB_stipe_center YFB_cap_skin 0.090151 no
YFB_stipe_center YFB_cap_tissue 0.038942 yes
YFB_stipe_center YFB_gill_tissue 0.748637 no
YFB_stipe_center YFB_veil 0.967706 no
YFB_stipe_shell YFB_stipe_skin 0.876171 no
YFB_stipe_shell YFB_cap_skin 0.019442 yes
YFB_stipe_shell YFB_cap_tissue 0.007782 yes
YFB_stipe_shell YFB_gill_tissue 0.362013 no
YFB_stipe_shell YFB_veil 0.747603 no
YFB_stipe_skin YFB_cap_skin 0.006387 yes
YFB_stipe_skin YFB_cap_tissue 0.002084 yes
YFB_stipe_skin YFB_gill_tissue 0.225375 no
YFB_stipe_skin YFB_veil 0.570822 no
YFB_cap_skin YFB_cap_tissue 0.885257 no
YFB_cap_skin YFB_gill_tissue 0.299456 no
YFB_cap_skin YFB_veil 0.080532 no
YFB_cap_tissue YFB_gill_tissue 0.171663 no
YFB_cap_tissue YFB_veil 0.035993 yes
YFB_gill_tissue YFB_veil 0.700955 no
Initials DIF_gill_tissue 0.768199 no
Initials YFB_stipe_center 0.996569 no
Initials YFB_stipe_shell 0.695094 no
Initials YFB_stipe_skin 0.508639 no
Initials YFB_cap_skin 0.089301 no
Initials YFB_cap_tissue 0.042260 yes
Initials YFB_gill_tissue 0.740283 no
Initials YFB_veil 0.971970 no
Initials Pileal_Stipeal_center 0.933609 no
Initials Pileal_Stipeal_shell 0.735099 no
Initials DIF_stipe_center 0.924874 no
Initials DIF_stipe_shell 0.187053 no
Initials DIF_stipe_skin 0.737672 no
Initials DIF_cap_skin 0.097279 no
Initials DIF_cap_tissue 0.055182 no
Pileal_Stipeal_center DIF_gill_tissue 0.670274 no
Pileal_Stipeal_center YFB_stipe_center 0.928527 no
Pileal_Stipeal_center YFB_stipe_shell 0.804398 no
Pileal_Stipeal_center YFB_stipe_skin 0.627725 no
Pileal_Stipeal_center YFB_cap_skin 0.066584 no
Pileal_Stipeal_center YFB_cap_tissue 0.029890 yes
Pileal_Stipeal_center YFB_gill_tissue 0.639158 no
Pileal_Stipeal_center YFB_veil 0.963467 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.638083 no
Pileal_Stipeal_center DIF_stipe_center 0.991957 no
Pileal_Stipeal_center DIF_stipe_shell 0.275539 no
Pileal_Stipeal_center DIF_stipe_skin 0.840169 no
Pileal_Stipeal_center DIF_cap_skin 0.073226 no
Pileal_Stipeal_center DIF_cap_tissue 0.039836 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.978525 no
Pileal_Stipeal_shell YFB_stipe_center 0.739892 no
Pileal_Stipeal_shell YFB_stipe_shell 0.351660 no
Pileal_Stipeal_shell YFB_stipe_skin 0.218638 no
Pileal_Stipeal_shell YFB_cap_skin 0.301751 no
Pileal_Stipeal_shell YFB_cap_tissue 0.172566 no
Pileal_Stipeal_shell YFB_gill_tissue 0.995451 no
Pileal_Stipeal_shell YFB_veil 0.698535 no
Pileal_Stipeal_shell DIF_stipe_center 0.623374 no
Pileal_Stipeal_shell DIF_stipe_shell 0.052547 no
Pileal_Stipeal_shell DIF_stipe_skin 0.393730 no
Pileal_Stipeal_shell DIF_cap_skin 0.323331 no
Pileal_Stipeal_shell DIF_cap_tissue 0.210312 no
DIF_stipe_center DIF_gill_tissue 0.656575 no
DIF_stipe_center YFB_stipe_center 0.921207 no
DIF_stipe_center YFB_stipe_shell 0.815815 no
DIF_stipe_center YFB_stipe_skin 0.641301 no
DIF_stipe_center YFB_cap_skin 0.060892 no
DIF_stipe_center YFB_cap_tissue 0.027698 yes
DIF_stipe_center YFB_gill_tissue 0.624557 no
DIF_stipe_center YFB_veil 0.956240 no
DIF_stipe_center DIF_stipe_shell 0.283077 no
DIF_stipe_center DIF_stipe_skin 0.851688 no
DIF_stipe_center DIF_cap_skin 0.069387 no
DIF_stipe_center DIF_cap_tissue 0.036911 yes
DIF_stipe_shell DIF_gill_tissue 0.062229 no
DIF_stipe_shell YFB_stipe_center 0.180324 no
DIF_stipe_shell YFB_stipe_shell 0.520960 no
DIF_stipe_shell YFB_stipe_skin 0.719785 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.054575 no
DIF_stipe_shell YFB_veil 0.223259 no
DIF_stipe_shell DIF_stipe_skin 0.479204 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.434044 no
DIF_stipe_skin YFB_stipe_center 0.730575 no
DIF_stipe_skin YFB_stipe_shell 0.976578 no
DIF_stipe_skin YFB_stipe_skin 0.846744 no
DIF_stipe_skin YFB_cap_skin 0.022892 yes
DIF_stipe_skin YFB_cap_tissue 0.009123 yes
DIF_stipe_skin YFB_gill_tissue 0.401404 no
DIF_stipe_skin YFB_veil 0.789105 no
DIF_stipe_skin DIF_cap_skin 0.022631 yes
DIF_stipe_skin DIF_cap_tissue 0.013186 yes
DIF_cap_skin DIF_gill_tissue 0.291857 no
DIF_cap_skin YFB_stipe_center 0.102993 no
DIF_cap_skin YFB_stipe_shell 0.016669 yes
DIF_cap_skin YFB_stipe_skin 0.008121 yes
DIF_cap_skin YFB_cap_skin 0.983860 no
DIF_cap_skin YFB_cap_tissue 0.865923 no
DIF_cap_skin YFB_gill_tissue 0.316605 no
DIF_cap_skin YFB_veil 0.090496 no
DIF_cap_skin DIF_cap_tissue 0.899040 no
DIF_cap_tissue DIF_gill_tissue 0.195445 no
DIF_cap_tissue YFB_stipe_center 0.058926 no
DIF_cap_tissue YFB_stipe_shell 0.011659 yes
DIF_cap_tissue YFB_stipe_skin 0.002525 yes
DIF_cap_tissue YFB_cap_skin 0.918236 no
DIF_cap_tissue YFB_cap_tissue 0.977925 no
DIF_cap_tissue YFB_gill_tissue 0.215044 no
DIF_cap_tissue YFB_veil 0.055979 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057830
MSTPFTFLAIVAEGGASASFVNRMGVAKANEMLIWGKKKEAQELLECGFINKIFPQQSVESFHREVRDLLKFELQ
GLDPAAILKVKSLIKAGLNDKNDFDAINLRESYAQAERFSSGAPFKRFSMIANKEIRHKL*
Coding >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGATGGGT
GTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGAAGCTCAAGAACTTTTGGAATGTGGATTTATT
AACAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAATTCGAGCTTCAA
GGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAAACGACTTTGAC
GCTATCAATCTTCGGGAAAGTTATGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATG
ATTGCCAACAAGGAAATCCGGCATAAATTGTAA
Transcript >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGATGGGT
GTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGAAGCTCAAGAACTTTTGGAATGTGGATTTATT
AACAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAATTCGAGCTTCAA
GGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAAACGACTTTGAC
GCTATCAATCTTCGGGAAAGTTATGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATG
ATTGCCAACAAGGAAATCCGGCATAAATTGTAA
Gene >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGGTCAGTTTCCTTTTCGTTAGGCCATTAACGCAAACTATACGCTTGGTGAT
TATAGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGAGTGAGTGAATTTGGAAGAGCCACTT
AACGCTCTCAATTTACCCGTGCACAGTGGGTGTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGA
AGCTCAAGAACTTTTGGAATGTGGATTTATTAAGTAGGTTCACCACTTTTATAACCCAAGTACTCGTCCAAACAA
AACCTGGCCCCAGCAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAAT
TCGAGCTTCAAGGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAA
ACGACTTTGACGCTATCAATCTTCGGGAAAGTTATGGTAAGATTTAATACATATCTTGTTTATCAAAGTTAGGTA
ACTTGGGCCCTCCCGATGTTGCAGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATGA
TTGCCAACAAGGAAATCCGGCATAAATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail