Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057830
Gene name
Locationscaffold_3:1257090..1257722
Strand+
Gene length (bp)632
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 9.5E-10 3 68

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08558|DCI1_YEAST Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCI1 PE=1 SV=1 4 135 1.0E-11
sp|Q05871|ECI1_YEAST 3,2-trans-enoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECI1 PE=1 SV=1 4 135 2.0E-11
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 3 116 1.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 3 116 1.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 3 116 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08558|DCI1_YEAST Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCI1 PE=1 SV=1 4 135 1.0E-11
sp|Q05871|ECI1_YEAST 3,2-trans-enoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECI1 PE=1 SV=1 4 135 2.0E-11
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 3 116 1.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 3 116 1.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 3 116 1.0E-07
sp|Q78JN3|ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus GN=Eci3 PE=1 SV=1 3 113 3.0E-07
sp|Q9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1 3 116 6.0E-07
sp|Q8N8U2|CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens GN=CDYL2 PE=1 SV=2 3 116 1.0E-06
sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 3 106 3.0E-06
sp|Q6AYK9|CDYL_RAT Chromodomain Y-like protein OS=Rattus norvegicus GN=Cdyl PE=1 SV=1 3 109 4.0E-06
sp|Q9D5D8|CDYL2_MOUSE Chromodomain Y-like protein 2 OS=Mus musculus GN=Cdyl2 PE=1 SV=1 3 116 5.0E-06
sp|Q9WTK2|CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus GN=Cdyl PE=1 SV=1 3 106 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057830
MSTPFTFLAIVAEGGASASFVNRMGVAKANEMLIWGKKKEAQELLECGFINKIFPQQSVESFHREVRDLLKFELQ
GLDPAAILKVKSLIKAGLNDKNDFDAINLRESYAQAERFSSGAPFKRFSMIANKEIRHKL*
Coding >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGATGGGT
GTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGAAGCTCAAGAACTTTTGGAATGTGGATTTATT
AACAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAATTCGAGCTTCAA
GGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAAACGACTTTGAC
GCTATCAATCTTCGGGAAAGTTATGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATG
ATTGCCAACAAGGAAATCCGGCATAAATTGTAA
Transcript >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGATGGGT
GTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGAAGCTCAAGAACTTTTGGAATGTGGATTTATT
AACAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAATTCGAGCTTCAA
GGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAAACGACTTTGAC
GCTATCAATCTTCGGGAAAGTTATGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATG
ATTGCCAACAAGGAAATCCGGCATAAATTGTAA
Gene >AgabiH97|057830
ATGTCCACACCTTTTACATTCCTTGGTCAGTTTCCTTTTCGTTAGGCCATTAACGCAAACTATACGCTTGGTGAT
TATAGCTATCGTCGCCGAGGGCGGCGCCAGTGCCAGTTTTGTTAACAGGAGTGAGTGAATTTGGAAGAGCCACTT
AACGCTCTCAATTTACCCGTGCACAGTGGGTGTTGCAAAGGCGAACGAGATGTTAATATGGGGAAAGAAAAAAGA
AGCTCAAGAACTTTTGGAATGTGGATTTATTAAGTAGGTTCACCACTTTTATAACCCAAGTACTCGTCCAAACAA
AACCTGGCCCCAGCAAAATCTTCCCACAGCAATCTGTAGAATCTTTCCATCGAGAAGTTCGCGATCTCTTAAAAT
TCGAGCTTCAAGGACTTGATCCTGCCGCTATTCTCAAAGTCAAGTCGTTGATCAAAGCTGGCCTGAATGATAAAA
ACGACTTTGACGCTATCAATCTTCGGGAAAGTTATGGTAAGATTTAATACATATCTTGTTTATCAAAGTTAGGTA
ACTTGGGCCCTCCCGATGTTGCAGCTCAGGCAGAAAGGTTCTCGAGTGGCGCCCCTTTCAAGCGGTTCTCGATGA
TTGCCAACAAGGAAATCCGGCATAAATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail