Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057550
Gene name
Locationscaffold_3:1197577..1199404
Strand+
Gene length (bp)1827
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.4E-06 133 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 24 420 4.0E-56
sp|Q5RK23|ABHD1_RAT Abhydrolase domain-containing protein 1 OS=Rattus norvegicus GN=Abhd1 PE=2 SV=1 59 393 2.0E-45
sp|Q9QZC8|ABHD1_MOUSE Abhydrolase domain-containing protein 1 OS=Mus musculus GN=Abhd1 PE=1 SV=2 59 393 1.0E-43
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 39 426 6.0E-43
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 45 412 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 24 420 4.0E-56
sp|Q5RK23|ABHD1_RAT Abhydrolase domain-containing protein 1 OS=Rattus norvegicus GN=Abhd1 PE=2 SV=1 59 393 2.0E-45
sp|Q9QZC8|ABHD1_MOUSE Abhydrolase domain-containing protein 1 OS=Mus musculus GN=Abhd1 PE=1 SV=2 59 393 1.0E-43
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 39 426 6.0E-43
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 45 412 1.0E-42
sp|Q96SE0|ABHD1_HUMAN Abhydrolase domain-containing protein 1 OS=Homo sapiens GN=ABHD1 PE=1 SV=2 59 393 3.0E-42
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 44 420 1.0E-41
sp|Q3T0A0|ABHD1_BOVIN Abhydrolase domain-containing protein 1 OS=Bos taurus GN=ABHD1 PE=2 SV=1 59 393 2.0E-41
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 60 412 6.0E-41
sp|Q8WU67|ABHD3_HUMAN Phospholipase ABHD3 OS=Homo sapiens GN=ABHD3 PE=1 SV=2 55 393 2.0E-35
sp|Q0VC00|ABHD3_BOVIN Phospholipase ABHD3 OS=Bos taurus GN=ABHD3 PE=2 SV=1 55 393 1.0E-34
sp|Q91ZH7|ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus GN=Abhd3 PE=1 SV=1 55 393 3.0E-34
sp|P45524|YHET_ECOLI Putative esterase YheT OS=Escherichia coli (strain K12) GN=yheT PE=3 SV=1 69 412 3.0E-30
sp|Q18610|YYC5_CAEEL Putative esterase C44C1.5 OS=Caenorhabditis elegans GN=C44C1.5 PE=3 SV=1 56 395 8.0E-28
sp|Q9QXM0|ABHD2_MOUSE Abhydrolase domain-containing protein 2 OS=Mus musculus GN=Abhd2 PE=1 SV=1 73 395 2.0E-25
sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A OS=Danio rerio GN=abhd2a PE=2 SV=1 73 395 4.0E-25
sp|Q05AK6|ABH2B_DANRE Abhydrolase domain-containing protein 2-B OS=Danio rerio GN=abhd2b PE=2 SV=1 73 395 5.0E-25
sp|Q4R2Y9|ABHD2_MACFA Abhydrolase domain-containing protein 2 OS=Macaca fascicularis GN=ABHD2 PE=2 SV=1 73 395 6.0E-25
sp|P08910|ABHD2_HUMAN Abhydrolase domain-containing protein 2 OS=Homo sapiens GN=ABHD2 PE=2 SV=1 73 395 7.0E-25
sp|Q5EA42|ABHD2_BOVIN Abhydrolase domain-containing protein 2 OS=Bos taurus GN=ABHD2 PE=2 SV=1 73 395 9.0E-25
sp|Q24093|ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster GN=Hydr2 PE=2 SV=2 73 393 2.0E-22
sp|Q6UXT9|ABH15_HUMAN Abhydrolase domain-containing protein 15 OS=Homo sapiens GN=ABHD15 PE=2 SV=2 73 417 3.0E-16
sp|Q5F2F2|ABH15_MOUSE Abhydrolase domain-containing protein 15 OS=Mus musculus GN=Abhd15 PE=1 SV=1 72 417 7.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057550
MDFIFGLSGLGIMATVLSVVSSKFPNFETTVHFPSDPVALPVRKRHAQDEIEYHSIRELVETHVPSILTDFKPLW
WLCNGHLQTLYCVVGDFSKQEKVSYKRTYLQLADGGTIGLDWAPQDQEFNPHLQDDTPIVVVQHGLTGGSFEPYV
RAVLSRSLLPKEKGGLGYRAVVINFRGCAGVPITSPRFYSAGHTDDTRNALLYIAHRYPKAPLLALGFSLGSNVI
TRYLGEEKANARLHAACALACPWDLEDNNDRLLGSFLGKHLYSKGMGGNLLKLLKRHSEAFLASFDKDDVVVQAA
AKAITLKSPTLEEFDQVFTSVAGGPPPHFPFPSAREYYQAMSSHHILRHVQIPYLAINAADDPVVQRVPLHDGSN
PFVVMGLTTGGGHLGWFQASGGGNVDRWTTQPVLDWLKLMGDDVVHNSTPRGNKIFIDNAGWLREEGREHLGCRE
LFEEGDIEGNNNEAGTLQGL*
Coding >AgabiH97|057550
ATGGACTTCATTTTCGGTCTCTCTGGGCTTGGAATCATGGCAACCGTCCTCTCCGTCGTTAGCAGCAAATTTCCC
AACTTCGAAACAACCGTTCACTTCCCCTCGGACCCGGTTGCACTCCCTGTGCGTAAGAGGCATGCCCAGGATGAA
ATCGAATATCATTCCATTAGGGAGCTCGTAGAAACGCACGTACCTAGTATTTTAACCGACTTTAAGCCACTGTGG
TGGTTGTGCAATGGACATCTCCAGACCCTGTATTGCGTGGTTGGCGACTTCTCGAAGCAAGAAAAGGTATCGTAC
AAACGGACATATTTACAACTCGCAGATGGGGGTACCATTGGTCTTGATTGGGCCCCTCAAGACCAGGAATTCAAT
CCACACTTGCAAGATGACACCCCCATTGTTGTTGTACAACACGGACTAACTGGAGGATCGTTTGAACCGTATGTT
CGTGCCGTCCTTAGTCGATCCCTTTTGCCTAAAGAAAAAGGAGGACTGGGATACCGTGCAGTAGTGATTAATTTC
CGAGGATGTGCTGGCGTCCCTATCACTAGTCCTCGGTTCTATTCTGCTGGGCACACGGATGACACTCGTAACGCA
TTATTATATATTGCACATCGATACCCTAAAGCCCCGCTGTTGGCCCTCGGATTTTCGCTTGGTTCTAACGTAATT
ACACGATATCTCGGCGAGGAGAAAGCAAACGCTCGATTGCACGCGGCGTGTGCGCTGGCATGTCCTTGGGATCTG
GAGGACAACAACGATAGGCTATTGGGTTCATTCCTCGGAAAGCACCTCTACTCAAAAGGGATGGGTGGTAATCTT
CTCAAGCTCCTAAAGCGACACAGCGAAGCCTTTCTAGCCAGCTTCGATAAGGACGATGTCGTAGTACAAGCAGCT
GCGAAAGCGATTACTCTCAAGAGTCCAACATTGGAAGAGTTTGATCAGGTTTTCACTAGTGTCGCCGGTGGGCCT
CCTCCACACTTCCCATTTCCATCCGCTCGCGAGTACTATCAGGCCATGTCCTCCCATCATATCCTCAGGCATGTT
CAGATCCCATATCTTGCCATTAACGCAGCGGATGATCCGGTGGTACAACGCGTGCCATTACATGATGGAAGTAAT
CCATTCGTGGTGATGGGGCTTACCACGGGAGGCGGACACCTTGGCTGGTTCCAGGCTAGCGGGGGAGGCAACGTG
GATCGATGGACAACGCAACCGGTCCTAGACTGGCTGAAGCTGATGGGAGATGACGTCGTTCATAACTCCACACCC
AGAGGAAATAAGATTTTTATTGATAATGCAGGGTGGCTAAGAGAAGAAGGTAGAGAGCATCTGGGATGCCGAGAA
CTCTTCGAAGAAGGTGACATTGAAGGGAATAATAATGAGGCGGGAACATTGCAGGGACTATGA
Transcript >AgabiH97|057550
ATGGACTTCATTTTCGGTCTCTCTGGGCTTGGAATCATGGCAACCGTCCTCTCCGTCGTTAGCAGCAAATTTCCC
AACTTCGAAACAACCGTTCACTTCCCCTCGGACCCGGTTGCACTCCCTGTGCGTAAGAGGCATGCCCAGGATGAA
ATCGAATATCATTCCATTAGGGAGCTCGTAGAAACGCACGTACCTAGTATTTTAACCGACTTTAAGCCACTGTGG
TGGTTGTGCAATGGACATCTCCAGACCCTGTATTGCGTGGTTGGCGACTTCTCGAAGCAAGAAAAGGTATCGTAC
AAACGGACATATTTACAACTCGCAGATGGGGGTACCATTGGTCTTGATTGGGCCCCTCAAGACCAGGAATTCAAT
CCACACTTGCAAGATGACACCCCCATTGTTGTTGTACAACACGGACTAACTGGAGGATCGTTTGAACCGTATGTT
CGTGCCGTCCTTAGTCGATCCCTTTTGCCTAAAGAAAAAGGAGGACTGGGATACCGTGCAGTAGTGATTAATTTC
CGAGGATGTGCTGGCGTCCCTATCACTAGTCCTCGGTTCTATTCTGCTGGGCACACGGATGACACTCGTAACGCA
TTATTATATATTGCACATCGATACCCTAAAGCCCCGCTGTTGGCCCTCGGATTTTCGCTTGGTTCTAACGTAATT
ACACGATATCTCGGCGAGGAGAAAGCAAACGCTCGATTGCACGCGGCGTGTGCGCTGGCATGTCCTTGGGATCTG
GAGGACAACAACGATAGGCTATTGGGTTCATTCCTCGGAAAGCACCTCTACTCAAAAGGGATGGGTGGTAATCTT
CTCAAGCTCCTAAAGCGACACAGCGAAGCCTTTCTAGCCAGCTTCGATAAGGACGATGTCGTAGTACAAGCAGCT
GCGAAAGCGATTACTCTCAAGAGTCCAACATTGGAAGAGTTTGATCAGGTTTTCACTAGTGTCGCCGGTGGGCCT
CCTCCACACTTCCCATTTCCATCCGCTCGCGAGTACTATCAGGCCATGTCCTCCCATCATATCCTCAGGCATGTT
CAGATCCCATATCTTGCCATTAACGCAGCGGATGATCCGGTGGTACAACGCGTGCCATTACATGATGGAAGTAAT
CCATTCGTGGTGATGGGGCTTACCACGGGAGGCGGACACCTTGGCTGGTTCCAGGCTAGCGGGGGAGGCAACGTG
GATCGATGGACAACGCAACCGGTCCTAGACTGGCTGAAGCTGATGGGAGATGACGTCGTTCATAACTCCACACCC
AGAGGAAATAAGATTTTTATTGATAATGCAGGGTGGCTAAGAGAAGAAGGTAGAGAGCATCTGGGATGCCGAGAA
CTCTTCGAAGAAGGTGACATTGAAGGGAATAATAATGAGGCGGGAACATTGCAGGGACTATGA
Gene >AgabiH97|057550
ATGGACTTCATTTTCGGTCTCTCTGGGCTTGGAATCATGGCAACCGTCCTCTCCGTCGTTAGCAGCAAATTTCCC
AACTTCGAAACAACCGTTCACTTCCCCTCGGACCCGGTTGCACTCCCTGTGCGTAAGAGGCATGCCCAGGATGAA
ATCGAATATCATTCCATTAGGGAGCTCGTAGAAACGCACGTACCTAGTATTTTAACCGACTTTAAGCCACTGTGG
TGGTTGTGCAAGTGAGTGCATATACATACCCCGAGCCGATGAATTTGCATCAACAAATATGCATAGTGGACATCT
CCAGACCCTGTATTGCGTGGTTGGCGACTTCTCGAAGCAAGAAAAGGTATCGTACAAACGGCAAGTTCACCTTGA
ACCGCTTGCGCCACAATCTTAACATTTAGGAAAACTCCAGGACATATTTACAACTCGCAGATGGGGGTACCATGT
GAGTTGTAGTGAACTGGTTCAAATAGGTTCAGTAATGAAATATCTCTGTCAGTGGTCTTGATTGGGCCCCTCAAG
ACCAGGAATTCAATCCACACTTGCAAGATGACACCCCCATTGTTGTTGTACAACACGGACTAACTGGAGGTAAGT
CCATCCCAACCGCTTCCACTTGATCGTCTATTTAGCTTATGTGGTCCAGGATCGTTTGAACCGTATGTTCGTGCC
GTCCTTAGTCGATCCCTTTTGCCTAAAGAAAAAGGAGGACTGGGATACCGTGCAGTAGTGATTAATTTCCGAGGA
TGTATGTCCCTGATTTTTGGCGATGCAAGAAGACAATCATCTGATGACCTCACGAACCACAGGTGCTGGCGTCCC
TATCACTAGTCCTCGGTTCTATTCTGCTGGGCACACGGATGACACTCGTAACGCATTATTATATATTGCACATCG
ATACCCTAAAGCCCCGCTGTTGGCCCTCGGATTTTCGCTTGGTTCTAACGTAATTACACGATATCTCGGCGAGGA
GAAAGCAAACGCTCGATTGCACGCGGCGTGTGCGCTGGCATGTGTGAGTTGTGAATAGAATTCAGATTAAAACGT
TTCGTTGATCAAACTTGCGGATATGTCGGCGATCTCGATCTCTCTAGCCTTGGGATCTGGAGGACAACAACGATA
GGTCATTGTTTGTGGTTTTTCAGTCCCTTCTATTTGTCTAATGCGGATTATACCAGGCTATTGGGTTCATTCCTC
GGAAAGCACCTCTACTCAAAAGGGATGGGTGGTAATCTTCTCAAGCTCCTAAAGCGACACAGCGAAGCCTTTCTA
GCCAGCTTCGATAAGGACGATGTCGTAGTACAAGCAGCTGCGAAAGCGATTACTCTCAAGAGTCCAACATTGGAA
GAGTTTGATCAGGTTTTCACTAGTGTCGCCGGTGGGCCTCCTCCACACTTCCCATTTCCATCCGCTCGCGAGTAC
TATCAGGCCATGTCCTCCCATCATATCCTCAGGCATGTTCAGATCCCATATCTTGCCATTAACGCAGCGGATGAT
CCGGTGGTACAACGCGTGCCATTACATGATGGAAGTAATCCATTCGTGGTGATGGGGCTTACCACGGGAGGCGGA
CACCTTGGCTGGTTCCAGGCTAGCGGGGGAGGCAACGTGGATCGATGGACAACGCAACCGGTCCTAGACTGGCTG
AAGCTGATGGGAGATGACGTCGTTCATAACTCCACACCCAGAGGAAATAAGATTTTTATTGATAATGCAGGGTGG
CTAAGAGAAGAAGGTAGAGAGCATCTGGGATGCCGAGAACTCTTCGAAGAAGGTGACATTGAAGGGAATAATAAT
GAGGCGGGAACATTGCAGGGACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail