Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057500
Gene name
Locationscaffold_3:1186764..1187460
Strand-
Gene length (bp)696
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 8.3E-11 45 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 10 163 4.0E-14
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 10 163 6.0E-14
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 10 163 7.0E-14
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 10 163 1.0E-13
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 10 163 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 10 163 4.0E-14
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 10 163 6.0E-14
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 10 163 7.0E-14
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 10 163 1.0E-13
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 10 163 1.0E-13
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 10 161 3.0E-13
sp|Q6NLA5|LPPG_ARATH Lipid phosphate phosphatase gamma, chloroplastic OS=Arabidopsis thaliana GN=LPPG PE=1 SV=1 35 161 2.0E-10
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 13 175 5.0E-09
sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum GN=dolpp1 PE=3 SV=1 35 161 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 90 112 22
3 119 138 19
4 142 164 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057500
MGAGIKKGHGFLSHAILSFLDKADAIVISLTAACILYTRSVGVVYFAAGASTCSITVKLIKRAIRQPRPPPHVLV
GRRVKASFGMPSTHSATITFFATYIAIASWCLPIHATLPAHARFVPIVTTPLAMTIVMSRIWLGYHTWPQVAVGC
AYGCSLAVMWFMLWTKGGVREVGQVLERGVWKLYGWS*
Coding >AgabiH97|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGCGGACGCT
ATCGTTATATCGCTGACCGCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTCTATTTTGCCGCCGGGGCT
TCAACATGCAGTATTACAGTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTT
GGGCGTAGGGTGAAAGCTTCGTTCGGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATT
GCCATTGCAAGTTGGTGTCTTCCTATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACA
CCTTTGGCTATGACGATTGTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGT
GCATATGGTTGTTCTCTGGCTGTGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTG
TTGGAAAGGGGTGTATGGAAGCTATACGGTTGGTCGTAG
Transcript >AgabiH97|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGCGGACGCT
ATCGTTATATCGCTGACCGCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTCTATTTTGCCGCCGGGGCT
TCAACATGCAGTATTACAGTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTT
GGGCGTAGGGTGAAAGCTTCGTTCGGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATT
GCCATTGCAAGTTGGTGTCTTCCTATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACA
CCTTTGGCTATGACGATTGTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGT
GCATATGGTTGTTCTCTGGCTGTGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTG
TTGGAAAGGGGTGTATGGAAGCTATACGGTTGGTCGTAG
Gene >AgabiH97|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGTGCGTCGT
CTGAGCTTTATGCCTAGCTCCAGGATTGACTCTCATTGGTTTCATGAGGCGGACGCTATCGTTATATCGCTGACC
GCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTCTATTTTGCCGCCGGGGCTTCAACATGCAGTATTACA
GTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTTGGGCGTAGGGTGAAAGCT
TCGTTCGGGTGAATGAACTTGGAATGAATAATTCAGCACGCCAATGAATACCACTATTAACCTTCTATTTGTCAA
CTCCACAGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATTGCCATTGCAAGTTGGTGT
CTTCCTATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACACCTTTGGCTATGACGATT
GTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGTGCATATGGTTGTTCTCTG
GCTGTGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTGTTGGAAAGGGGTGTATGG
AAGCTATACGGTTGGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail