Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057390
Gene name
Locationscaffold_3:1150362..1152591
Strand-
Gene length (bp)2229
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 6.0E-16 50 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 22 302 4.0E-43
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 22 302 4.0E-43
sp|Q00012|MANA_ASPAC Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus GN=manA PE=1 SV=1 9 289 2.0E-42
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 20 299 3.0E-42
sp|Q0CUG5|MANA2_ASPTN Probable mannan endo-1,4-beta-mannosidase A-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-2 PE=3 SV=2 37 289 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 22 302 4.0E-43
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 22 302 4.0E-43
sp|Q00012|MANA_ASPAC Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus GN=manA PE=1 SV=1 9 289 2.0E-42
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 20 299 3.0E-42
sp|Q0CUG5|MANA2_ASPTN Probable mannan endo-1,4-beta-mannosidase A-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-2 PE=3 SV=2 37 289 1.0E-41
sp|B8NVK8|MANA_ASPFN Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manA PE=3 SV=2 39 289 2.0E-41
sp|Q2TXJ2|MANA_ASPOR Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manA PE=3 SV=1 39 289 2.0E-41
sp|A1D8Y6|MANA_NEOFI Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manA PE=3 SV=1 35 289 6.0E-41
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 38 302 2.0E-40
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 35 289 2.0E-39
sp|Q0CCD0|MANA1_ASPTN Probable mannan endo-1,4-beta-mannosidase A-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-1 PE=3 SV=1 20 289 9.0E-39
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 35 289 1.0E-38
sp|A2QKT4|MANA_ASPNC Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=manA PE=1 SV=1 44 289 1.0E-38
sp|Q5B7X2|MANA_EMENI Mannan endo-1,4-beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manA PE=1 SV=1 35 285 6.0E-38
sp|Q5AVP1|MAND_EMENI Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manD PE=3 SV=1 41 289 6.0E-38
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 38 289 7.0E-38
sp|A1CGC6|MANA_ASPCL Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manA PE=3 SV=1 39 289 2.0E-33
sp|Q5AZ53|MANC_EMENI Mannan endo-1,4-beta-mannosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manC PE=2 SV=1 39 294 2.0E-32
sp|Q0C8J3|MANC_ASPTN Probable mannan endo-1,4-beta-mannosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manC PE=3 SV=1 9 288 5.0E-29
sp|Q5B833|MANB_EMENI Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manB PE=2 SV=2 44 291 6.0E-28
sp|Q0JKM9|MAN1_ORYSJ Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica GN=MAN1 PE=2 SV=2 39 306 2.0E-21
sp|Q2RBB1|MAN7_ORYSJ Mannan endo-1,4-beta-mannosidase 7 OS=Oryza sativa subsp. japonica GN=MAN7 PE=2 SV=3 40 299 4.0E-20
sp|Q9SG95|MAN4_ARATH Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana GN=MAN4 PE=3 SV=1 6 296 5.0E-20
sp|Q0IQJ7|MAN8_ORYSJ Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica GN=MAN8 PE=2 SV=2 40 299 3.0E-19
sp|Q9LW44|MANP_ARATH Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana GN=MANP PE=5 SV=3 6 296 3.0E-18
sp|Q8L5J1|MAN4_SOLLC Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum GN=MAN4 PE=1 SV=2 13 299 4.0E-18
sp|Q6Z310|MAN9_ORYSJ Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica GN=MAN9 PE=2 SV=2 35 298 5.0E-18
sp|Q9FJZ3|MAN7_ARATH Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana GN=MAN7 PE=2 SV=1 32 296 7.0E-18
sp|Q5W6G0|MAN5_ORYSJ Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica GN=MAN5 PE=2 SV=2 32 301 1.0E-17
sp|Q9M0H6|MAN5_ARATH Mannan endo-1,4-beta-mannosidase 5 OS=Arabidopsis thaliana GN=MAN5 PE=2 SV=1 10 296 3.0E-17
sp|Q6YM50|MAN5_SOLLC Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum GN=MAN5 PE=2 SV=1 13 296 3.0E-17
sp|Q9FZ03|MAN2_SOLLC Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum GN=MAN2 PE=2 SV=2 13 296 3.0E-17
sp|Q9FZ29|MAN1_ARATH Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana GN=MAN1 PE=2 SV=1 33 296 6.0E-17
sp|Q10B67|MAN4_ORYSJ Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica GN=MAN4 PE=2 SV=2 22 289 9.0E-17
sp|Q9LZV3|MAN6_ARATH Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana GN=MAN6 PE=2 SV=1 23 295 5.0E-16
sp|Q0JJD4|MAN2_ORYSJ Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica GN=MAN2 PE=2 SV=2 39 289 7.0E-16
sp|Q9SG94|MAN3_ARATH Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana GN=MAN3 PE=2 SV=1 6 296 1.0E-15
sp|Q7Y223|MAN2_ARATH Mannan endo-1,4-beta-mannosidase 2 OS=Arabidopsis thaliana GN=MAN2 PE=2 SV=1 10 307 1.0E-15
sp|O48540|MAN1_SOLLC Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum GN=MAN1 PE=1 SV=2 35 296 1.0E-15
sp|Q0DM48|MAN3_ORYSJ Mannan endo-1,4-beta-mannosidase 3 OS=Oryza sativa subsp. japonica GN=MAN3 PE=2 SV=2 51 289 2.0E-14
sp|Q9FUQ6|MAN3_SOLLC Mannan endo-1,4-beta-mannosidase 3 OS=Solanum lycopersicum GN=MAN3 PE=3 SV=1 35 296 6.0E-14
sp|Q0DCM5|MAN6_ORYSJ Mannan endo-1,4-beta-mannosidase 6 OS=Oryza sativa subsp. japonica GN=MAN6 PE=2 SV=2 51 289 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057390
MFVRSCWPLLLSLLFCNAFAKPSTKREVIPRDTGASSNFVTQQGDKLMVNGSTFNYIGTTAYWLSSLNTDEDIDF
TLGNISQAGFNVVRTWAFNDVETIPENGTWIQLIQNGTLLINEGPNGLQRLDKVIELAKKHGLYILLSLTNNWNP
RPLTDNIQVVDPLSALRLGARDVTPGTNNSLPRGFLSNDYGGMDAYVRQFGGPREHDQFFTNQTLINAFKNFTSQ
IVSRYANNTNVLAWELANDPQCSSSINASSSCIAQHVTRWHSDVAQHVKQLDPNHIVASGHQGFLCTDCPKLFPR
VTAPPPRPSPRAEARRSVLPWTRERILKERKEAFKKTRELAKKSGQSGDGIRIRGRWVSTPTRRQDSGLGSAFDG
SHGVDSEDIFNIPEIGLGSFMVFPDQVKYGPDDPNLPPFNNTVKQGQDWIRSNVDMARLFGKPVTMSGFGLVTQP
NTQAFVPFNSSVAPFASDSNLAPQTPFATNDQQIDAYQQWMQTGILGGVQGMIHYQWMQPGLTAQPGTTISPDVT
QAPTSPDITHTTSSPNDGYGDQDTAPLSSIVQQFAPDFQNRQGTVVV*
Coding >AgabiH97|057390
ATGTTCGTCCGCTCCTGCTGGCCGCTGCTTTTGTCCTTGCTATTCTGCAATGCTTTCGCTAAACCCAGTACGAAA
CGAGAAGTCATCCCGCGCGATACTGGCGCGTCATCCAATTTCGTGACACAACAGGGCGATAAGCTGATGGTCAAT
GGAAGTACCTTCAACTACATCGGCACAACAGCGTACTGGCTGTCGTCCTTGAATACAGACGAAGACATCGACTTC
ACTCTCGGGAACATCTCTCAAGCAGGATTCAACGTTGTCAGGACTTGGGCGTTTAATGACGTTGAGACTATTCCC
GAAAATGGAACCTGGATCCAATTGATCCAAAATGGAACTTTGCTTATCAACGAAGGTCCTAATGGGCTACAGAGG
CTAGACAAGGTCATAGAACTTGCCAAAAAACATGGCTTATACATCCTACTCTCTCTCACAAATAATTGGAATCCT
CGACCACTGACGGATAACATCCAAGTCGTTGATCCCCTCAGCGCCCTCCGCCTCGGAGCACGCGATGTCACTCCC
GGAACTAATAATTCACTTCCAAGGGGCTTTCTGAGTAATGATTATGGTGGTATGGACGCTTATGTCCGACAATTC
GGCGGCCCACGAGAACACGATCAATTCTTCACTAACCAGACTCTGATCAACGCTTTCAAGAACTTTACTAGCCAA
ATCGTCTCCCGCTACGCCAACAACACGAATGTGCTTGCCTGGGAACTTGCTAATGATCCTCAATGCTCATCGTCG
ATCAATGCCTCTTCTTCTTGTATTGCACAACACGTTACTCGGTGGCATTCCGACGTTGCGCAGCACGTTAAGCAA
CTCGATCCCAACCACATTGTTGCCAGCGGACATCAAGGATTTTTGTGTACGGATTGCCCTAAGCTCTTCCCCCGT
GTCACTGCACCTCCCCCTCGTCCGTCCCCTCGTGCCGAGGCACGCCGTAGTGTACTCCCTTGGACCAGAGAACGA
ATCTTGAAGGAGCGCAAGGAAGCATTCAAGAAAACGAGAGAGCTCGCCAAGAAGTCCGGTCAGTCTGGAGATGGT
ATTCGAATTCGGGGACGCTGGGTGTCTACTCCAACTCGCCGACAAGACTCTGGTTTGGGATCAGCCTTCGATGGT
TCACATGGCGTTGACAGTGAGGACATCTTTAACATTCCGGAGATCGGGCTCGGTAGTTTCATGGTATTCCCCGAC
CAAGTCAAGTATGGACCTGATGACCCTAACTTGCCTCCTTTCAACAATACGGTTAAACAAGGGCAGGACTGGATA
AGATCTAACGTTGACATGGCTCGTCTTTTTGGGAAACCTGTTACAATGTCTGGCTTCGGCCTTGTTACGCAACCA
AATACTCAGGCTTTCGTACCTTTTAACTCGTCCGTTGCACCATTTGCTTCCGATTCCAATCTGGCCCCCCAAACA
CCTTTTGCCACAAATGACCAGCAAATCGATGCCTATCAACAGTGGATGCAAACTGGTATTCTCGGCGGCGTTCAA
GGCATGATTCACTACCAATGGATGCAGCCAGGACTTACGGCGCAACCTGGAACAACCATCTCACCCGATGTGACT
CAAGCCCCAACTTCGCCAGATATAACTCACACAACCTCCTCCCCCAACGATGGTTATGGTGATCAGGATACGGCA
CCCCTGAGCTCCATTGTTCAACAATTTGCTCCAGACTTCCAAAACCGTCAGGGCACCGTCGTGGTTTAG
Transcript >AgabiH97|057390
ATGTTCGTCCGCTCCTGCTGGCCGCTGCTTTTGTCCTTGCTATTCTGCAATGCTTTCGCTAAACCCAGTACGAAA
CGAGAAGTCATCCCGCGCGATACTGGCGCGTCATCCAATTTCGTGACACAACAGGGCGATAAGCTGATGGTCAAT
GGAAGTACCTTCAACTACATCGGCACAACAGCGTACTGGCTGTCGTCCTTGAATACAGACGAAGACATCGACTTC
ACTCTCGGGAACATCTCTCAAGCAGGATTCAACGTTGTCAGGACTTGGGCGTTTAATGACGTTGAGACTATTCCC
GAAAATGGAACCTGGATCCAATTGATCCAAAATGGAACTTTGCTTATCAACGAAGGTCCTAATGGGCTACAGAGG
CTAGACAAGGTCATAGAACTTGCCAAAAAACATGGCTTATACATCCTACTCTCTCTCACAAATAATTGGAATCCT
CGACCACTGACGGATAACATCCAAGTCGTTGATCCCCTCAGCGCCCTCCGCCTCGGAGCACGCGATGTCACTCCC
GGAACTAATAATTCACTTCCAAGGGGCTTTCTGAGTAATGATTATGGTGGTATGGACGCTTATGTCCGACAATTC
GGCGGCCCACGAGAACACGATCAATTCTTCACTAACCAGACTCTGATCAACGCTTTCAAGAACTTTACTAGCCAA
ATCGTCTCCCGCTACGCCAACAACACGAATGTGCTTGCCTGGGAACTTGCTAATGATCCTCAATGCTCATCGTCG
ATCAATGCCTCTTCTTCTTGTATTGCACAACACGTTACTCGGTGGCATTCCGACGTTGCGCAGCACGTTAAGCAA
CTCGATCCCAACCACATTGTTGCCAGCGGACATCAAGGATTTTTGTGTACGGATTGCCCTAAGCTCTTCCCCCGT
GTCACTGCACCTCCCCCTCGTCCGTCCCCTCGTGCCGAGGCACGCCGTAGTGTACTCCCTTGGACCAGAGAACGA
ATCTTGAAGGAGCGCAAGGAAGCATTCAAGAAAACGAGAGAGCTCGCCAAGAAGTCCGGTCAGTCTGGAGATGGT
ATTCGAATTCGGGGACGCTGGGTGTCTACTCCAACTCGCCGACAAGACTCTGGTTTGGGATCAGCCTTCGATGGT
TCACATGGCGTTGACAGTGAGGACATCTTTAACATTCCGGAGATCGGGCTCGGTAGTTTCATGGTATTCCCCGAC
CAAGTCAAGTATGGACCTGATGACCCTAACTTGCCTCCTTTCAACAATACGGTTAAACAAGGGCAGGACTGGATA
AGATCTAACGTTGACATGGCTCGTCTTTTTGGGAAACCTGTTACAATGTCTGGCTTCGGCCTTGTTACGCAACCA
AATACTCAGGCTTTCGTACCTTTTAACTCGTCCGTTGCACCATTTGCTTCCGATTCCAATCTGGCCCCCCAAACA
CCTTTTGCCACAAATGACCAGCAAATCGATGCCTATCAACAGTGGATGCAAACTGGTATTCTCGGCGGCGTTCAA
GGCATGATTCACTACCAATGGATGCAGCCAGGACTTACGGCGCAACCTGGAACAACCATCTCACCCGATGTGACT
CAAGCCCCAACTTCGCCAGATATAACTCACACAACCTCCTCCCCCAACGATGGTTATGGTGATCAGGATACGGCA
CCCCTGAGCTCCATTGTTCAACAATTTGCTCCAGACTTCCAAAACCGTCAGGGCACCGTCGTGGTTTAG
Gene >AgabiH97|057390
ATGTTCGTCCGCTCCTGCTGGCCGCTGCTTTTGTCCTTGCTATTCTGCAATGCTTTCGCTAAACCCAGTACGAAA
CGAGAAGTCATCCCGCGCGATACTGGCGCGTCATCCAATTTCGTGACACAACAGGGCGATAAGCTGATGGTCAAT
GGAAGGTAAGCTCTTTCATATTTTTCGCCCTGTCGCACTCCTTGAATTTTCGTAAAGTACCTTCAACTACATCGG
CACAACAGCGTACTGGCTGTCGTCCTTGAATACAGACGAAGACATCGACTTCACTCTCGGGAACATCTCTCAAGC
AGGATTCAACGTTGTCAGGACTTGGGCGTTTAATGGTGCGCATCGTGGGACTTCCCGTCTGTTTTTACAACTGAT
ACTCATCTTATAAAATTCCAGACGTTGAGACTATTCCCGAAAATGGAACCTGGATCCAATTGATCCAAAATGGAA
CTTTGCTTATCAACGAAGGTCCTAATGGGCTACAGAGGCTAGACAAGGTCATAGAACTTGCCAAAAAACATGGCT
TATACATCCTACTCTCTCTCACAAATAATTGGAATCCTCGACCACTGACGGATAACATCCAAGTCGTTGATCCCC
TCAGCGCCCTCCGCCTCGGAGCACGCGATGTCACTCCCGGAACTAATAATTCACTTCCAAGGGGCTTTCTGAGTA
ATGATTATGGTGCGTTAGCTGCTCCCCCTTCAGGTCAAGTCTGATTTGGCTACCGAAGGTGGTATGGACGCTTAT
GTCCGACAATTCGGCGGCCCACGAGAACACGATCAATTCTTCACTAACCAGACTCTGATCAACGCTTTCAAGAAC
TTTACTAGCCAAATCGTCTCCCGCTACGCCAACAACACGAATGTGCTTGCCTGGTAAGTAGGCTCGTACTCGCTA
CAGTTTCGTGAAACTCAAGGAATTCTGATAGGGAACTTGCTAATGATCCTCAATGCTCATCGTCGATCAATGCCT
CTTCTTCTTGTATTGCACAACACGTTACTCGGTGGCATTCCGACGTTGCGCAGCACGTTAAGCAACTCGATCCCA
ACCACATTGTTGCCAGCGGGTTGGTTGATATTTAGCTCCTCGTTTCACCTTGAACTTATCAATCGTGATAGACAT
CAAGGATTTTTGTGTACGGATTGCCCTAAGCTCTTCCCCCGTGTCACTGCACCTCCCCCTCGTCCGTCCCCTCGT
GCCGAGGCACGCCGTAGTGTACTCCCTTGGACCAGAGAACGAATCTTGAAGGAGCGCAAGGAAGCATTCAAGAAA
ACGAGAGAGCTCGCCAAGAAGTCCGGTCAGTCTGGAGATGGTATTCGAATTCGGGGACGCTGGGTGTCTACTCGT
GAGTTTCCATTCTGCCAGATTATGGTGATATTTAACGGCCAAATAGCAACTCGCCGACAAGACTCTGGTTTGGGA
TCAGCCTTCGATGGTTCACATGGCGTTGACAGTGAGGACATCTTTAACATTCCGGAGATCGGGCTCGGTAGTTTC
ATGGTATTCCCCGACCAAGTCAAGTATGGACCTGATGACCCTAACTTGCCTCCTTTCAACAATACGGTTAAACAA
GGGCAGGACTGGATAAGATCTAACGTTGACATGGCTCGTCTGTGAGTATTTATACACAGTGCTTTTCTCGACTCT
AAGTCTCTTGTAGTTTTGGGAAACCTGTTACAATGTCTGGCTTCGGCCTTGTTACGCAACCAAATACTCAGGCTT
TCGTACCTTTTAACTCGTCCGTTGCACCATTTGCTTCCGATTGTGAGTCCTCTTCAGGCTGTTTCTTATCGAGCG
ATTCTAAACGTTTTGTAGCCAATCTGGCCCCCCAAACACCTTTTGCCACAAATGACCAGCAAATCGATGCCTATC
AACAGTGGATGCAAAGTAGGTTGTGTTTTATTTTGTTACTCCCTGATTGACGATATGTTATAGCTGGTATTCTCG
GCGGCGTTCAAGGCATGATTCACTACCAATGGATGCAGCCAGGACTTACGGCGCAACCTGGAACAACCATCTCAC
CCGATGTGACTCAAGCCCCAACTTCGCCAGATATAACTCACACAACCTCCTCCCCCAACGATGGTTATGGTGATC
AGGATACGGCGTAAGTTTGTCTCAGTTTTCTGTGAAGATTTACCCTGAACTTGCTTTAGACCCCTGAGCTCCATT
GTTCAACAATTTGCTCCAGACTTCCAAAACCGTCAGGGCACCGTCGTGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail