Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057310
Gene name
Locationscaffold_3:1131471..1133823
Strand-
Gene length (bp)2352
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12222 PNGaseA Peptide N-acetyl-beta-D-glucosaminyl asparaginase amidase A 6.2E-133 34 452

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P81898|PNAA_PRUDU Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A OS=Prunus dulcis PE=1 SV=2 27 415 4.0E-61

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057310
MRTLFLVRKVLGLLVAAVVFARAARLVDFQVAQPPPVPQDAKQCTIQVLQRDFAFSFGMEEIVQLEPPTDCGPPG
SWAAITLNFTVTSNGTQFDRLGIFTFQNVEIWRTSTPEPTRGDGIIWTYIKDVTRYTPLFAKPGTFILQLDNLIQ
TGLDGVYSTVLEATYYASSDEHPPAQQSDLIVPLSTLKNNTGNQASVPPGFSIDVTLPQNAVQVYAELYASGNGN
EEFWYFNVPNKFVGDIPEGFTLGQGPFREVRLLIDDQVAGVAFPYISIFTGGFTPPSWRPITSYGALDLPTYFID
VTPFVPLLTDGKAHSFTIDVVSAESNHTILQNWFVSGNLQVFTDPSGRPTTGEMLEIDNQPFAETQTEGRVESNG
DVTFSVKATRRIRIKSQITSGSGDTSNVTWTQEMRYVNSQQWLNNFLIQNVQQSAKGEFKSIRDGELTLEDRFSY
PLNINFSYLNENLTDWFTTFDHSYERDLLPMPTIVRSKTNNRQLADGFFHLAPTGNTGNGTNSNVFSYSDEAKNT
YNRKVNAEFNNITLDVESGNLAPAPAPLPLTDRLIPQSGYSNPRRPGVRDD*
Coding >AgabiH97|057310
ATGAGGACCCTTTTTCTTGTTCGCAAAGTTCTCGGCTTGCTTGTGGCTGCGGTTGTGTTTGCTCGCGCTGCAAGA
CTTGTGGATTTTCAAGTAGCTCAACCACCGCCTGTACCACAAGATGCGAAGCAATGCACAATTCAGGTGCTGCAG
AGGGATTTTGCTTTCTCTTTTGGAATGGAGGAAATTGTTCAACTCGAACCTCCGACTGATTGTGGACCTCCTGGA
TCATGGGCTGCCATCACATTGAATTTCACTGTCACTTCCAACGGAACCCAATTTGACAGACTTGGTATCTTCACT
TTCCAAAACGTCGAAATTTGGCGAACATCGACTCCGGAACCTACTCGAGGAGATGGAATTATCTGGACTTATATC
AAAGACGTCACTCGATATACCCCACTATTCGCCAAACCTGGAACTTTCATTTTACAACTCGACAATCTCATTCAA
ACTGGCCTCGATGGCGTCTACTCCACTGTGCTGGAGGCGACCTATTACGCATCGTCAGATGAACATCCACCAGCA
CAACAATCGGATCTGATAGTTCCCCTTTCTACACTTAAGAATAACACAGGAAATCAAGCCTCTGTTCCTCCTGGG
TTTTCTATCGACGTTACACTCCCACAAAATGCAGTACAAGTCTACGCAGAATTATATGCATCTGGGAACGGAAAT
GAAGAATTTTGGTATTTCAATGTTCCGAACAAATTCGTTGGAGATATTCCCGAAGGTTTCACACTTGGCCAAGGT
CCATTCCGTGAGGTTCGTCTCCTCATCGACGACCAAGTCGCAGGTGTGGCTTTCCCATATATATCCATTTTCACT
GGTGGCTTCACACCTCCGAGTTGGAGACCTATCACTTCTTATGGCGCTCTTGACCTTCCGACATACTTTATCGAC
GTCACACCTTTCGTACCTTTGTTAACGGACGGAAAAGCTCACAGCTTCACTATCGACGTCGTCTCAGCCGAATCA
AATCACACGATACTACAAAATTGGTTTGTCTCCGGTAATCTTCAAGTGTTCACTGATCCCTCTGGTCGACCTACA
ACTGGAGAAATGTTGGAAATCGATAATCAACCTTTTGCTGAAACGCAGACGGAGGGTAGGGTAGAATCGAATGGA
GATGTGACGTTCAGTGTCAAGGCTACGAGGCGTATTCGTATCAAATCACAAATTACTAGTGGAAGTGGGGACACG
TCGAACGTCACTTGGACACAAGAAATGCGATACGTAAATTCTCAACAGTGGCTGAACAATTTCTTGATACAGAAT
GTGCAACAATCAGCTAAAGGGGAATTCAAGTCTATCCGCGACGGAGAGTTGACATTGGAAGATCGTTTCTCTTAT
CCGTTGAACATCAATTTCAGTTATCTCAATGAGAATTTGACCGACTGGTTTACGACCTTTGATCATTCTTACGAA
CGAGATCTTCTTCCCATGCCCACCATCGTTCGAAGCAAAACCAACAATCGCCAACTGGCAGATGGATTTTTCCAC
CTTGCGCCTACGGGTAACACTGGCAATGGCACGAATAGCAACGTTTTTAGCTACAGCGACGAGGCCAAGAACACC
TATAACAGAAAGGTCAATGCCGAGTTTAACAACATTACACTCGATGTCGAATCCGGCAATCTTGCCCCAGCTCCG
GCACCGTTGCCTCTTACAGACAGGTTGATCCCTCAGTCAGGCTACAGCAACCCCAGACGTCCTGGCGTAAGGGAC
GACTGA
Transcript >AgabiH97|057310
ATGAGGACCCTTTTTCTTGTTCGCAAAGTTCTCGGCTTGCTTGTGGCTGCGGTTGTGTTTGCTCGCGCTGCAAGA
CTTGTGGATTTTCAAGTAGCTCAACCACCGCCTGTACCACAAGATGCGAAGCAATGCACAATTCAGGTGCTGCAG
AGGGATTTTGCTTTCTCTTTTGGAATGGAGGAAATTGTTCAACTCGAACCTCCGACTGATTGTGGACCTCCTGGA
TCATGGGCTGCCATCACATTGAATTTCACTGTCACTTCCAACGGAACCCAATTTGACAGACTTGGTATCTTCACT
TTCCAAAACGTCGAAATTTGGCGAACATCGACTCCGGAACCTACTCGAGGAGATGGAATTATCTGGACTTATATC
AAAGACGTCACTCGATATACCCCACTATTCGCCAAACCTGGAACTTTCATTTTACAACTCGACAATCTCATTCAA
ACTGGCCTCGATGGCGTCTACTCCACTGTGCTGGAGGCGACCTATTACGCATCGTCAGATGAACATCCACCAGCA
CAACAATCGGATCTGATAGTTCCCCTTTCTACACTTAAGAATAACACAGGAAATCAAGCCTCTGTTCCTCCTGGG
TTTTCTATCGACGTTACACTCCCACAAAATGCAGTACAAGTCTACGCAGAATTATATGCATCTGGGAACGGAAAT
GAAGAATTTTGGTATTTCAATGTTCCGAACAAATTCGTTGGAGATATTCCCGAAGGTTTCACACTTGGCCAAGGT
CCATTCCGTGAGGTTCGTCTCCTCATCGACGACCAAGTCGCAGGTGTGGCTTTCCCATATATATCCATTTTCACT
GGTGGCTTCACACCTCCGAGTTGGAGACCTATCACTTCTTATGGCGCTCTTGACCTTCCGACATACTTTATCGAC
GTCACACCTTTCGTACCTTTGTTAACGGACGGAAAAGCTCACAGCTTCACTATCGACGTCGTCTCAGCCGAATCA
AATCACACGATACTACAAAATTGGTTTGTCTCCGGTAATCTTCAAGTGTTCACTGATCCCTCTGGTCGACCTACA
ACTGGAGAAATGTTGGAAATCGATAATCAACCTTTTGCTGAAACGCAGACGGAGGGTAGGGTAGAATCGAATGGA
GATGTGACGTTCAGTGTCAAGGCTACGAGGCGTATTCGTATCAAATCACAAATTACTAGTGGAAGTGGGGACACG
TCGAACGTCACTTGGACACAAGAAATGCGATACGTAAATTCTCAACAGTGGCTGAACAATTTCTTGATACAGAAT
GTGCAACAATCAGCTAAAGGGGAATTCAAGTCTATCCGCGACGGAGAGTTGACATTGGAAGATCGTTTCTCTTAT
CCGTTGAACATCAATTTCAGTTATCTCAATGAGAATTTGACCGACTGGTTTACGACCTTTGATCATTCTTACGAA
CGAGATCTTCTTCCCATGCCCACCATCGTTCGAAGCAAAACCAACAATCGCCAACTGGCAGATGGATTTTTCCAC
CTTGCGCCTACGGGTAACACTGGCAATGGCACGAATAGCAACGTTTTTAGCTACAGCGACGAGGCCAAGAACACC
TATAACAGAAAGGTCAATGCCGAGTTTAACAACATTACACTCGATGTCGAATCCGGCAATCTTGCCCCAGCTCCG
GCACCGTTGCCTCTTACAGACAGGTTGATCCCTCAGTCAGGCTACAGCAACCCCAGACGTCCTGGCGTAAGGGAC
GACTGA
Gene >AgabiH97|057310
ATGAGGACCCTTTTTCTTGTTCGCAAAGTTCTCGGCTTGCTTGTGGCTGCGGTTGTGTTTGCTCGCGCTGCAAGA
CTTGTGGATTTTCAAGTAGCTCAACCACCGCCTGTACCACAAGATGCGAAGCAATGCACAATTCAGGTGCTGCAG
TGAGTTTATCTGTGGGTGCTTGAGAAGCAGAAAAGATAACCTACATTTCTTTGCGCAGGAGGGATTTTGCTTTCT
CTTTTGGAATGTAAGTGTTTGTAAAAGTATTTGTGGGTCGTCAGTGATTTTTGATGATGGAAATTTAGGGAGGAA
ATTGTTCAACTCGAGTGAGATCTGGCTAGTAGTGTCTGTTGGGAACAAATTGTTAAAATGACTTATTTTTGAAGA
CCTCCGACTGATTGTGGACCTCCTGGATCATGGGCTGCCATCACATTGAATTTCACTGTCACTTCCAACGGAACC
CAATTTGACAGACTTGGTATCTTCACTTTCCAAAACGTCGAAAGTACGTTTTTTTTTTTCCATTTTGCGACTTTT
AAGTTCTTATTTAACGTTTTTAAATTCCAGTTTGGCGAACATCGACTCCGGAACCTACTCGAGGAGATGGAATTA
TCTGGACTTATATCAAAGACGTCACTCGATATACCCCACTATTCGCCAAACCTGGAACTTTCATTTTACAACTCG
ACAATCTCATTCAAACTGGCCTCGATGGCGTCTACTCCAGTGCGTTGTTACGCATATATATTTGTATCCAAAGAT
GTTCATACTTTCATTAGCTGTGCTGGAGGCGACCTATTACGCATCGTCAGATGAACATCCACCAGCACAACAATC
GGATCTGATAGTTCCCCTTTCTACACTTAAGAATAACACAGGAAATCAAGCCTCTGTTCCTCCTGGGTTTTCTGT
AAGTATTCTCAATGATCCCTTTTTGTTCATTTTCTTGAAACTACTTCCTCAAGATCGACGTTACACTCCCACAAA
ATGCAGTACAAGTCTACGCAGAATTATATGCATCTGGGAACGGAAATGAAGAATTTTGGGTAAGCCTCCCTGTGC
ATCACTTAACGAGCTCGGTTATGCATTTATCTAGTATTTCAATGTTCCGAACAAATTCGTTGGAGATATTCCCGA
AGGTTTCACACTTGGCCAAGGTCCATTCCGTGAGGTTCGTCTCCTCATCGACGACCAAGTCGCAGGTGTGGCTTT
CCCATATATATCCATTTTCACTGGTGGCTTCACACCTCCGAGTTGGAGGTAAGGTGCTTTCCTTTTGATATTATT
GACTCTAATGTCTTTTTTTTTGGTAGACCTATCACTTCTTATGGCGCTCTTGACCTTCCGACATACTTTATCGAC
GTCACACCTTTCGTACCTTTGTTAACGGACGGAAAAGCTCACAGCTTCACTATCGACGTCGTCTCAGCCGAATCA
AATCACACGATACTACAAAATTGGTTTGTCTCCGGTAATCTTCAAGTGTTCACTGATCCCTCTGGTCGACCTACA
ACTGGAGAAATGTTGGAAATCGATAATCAACCTTTTGCTGAAACGCAGACGGAGGGTAGGGTAGAATCGAATGGA
GATGTGACGTTCAGTGTCAAGGCTACGAGGCGTATTCGTATCAAATCACAAATTACTAGTGGAAGTGGGGACACG
TCGAACGTCACTTGGACACAAGAAATGCGATACGTAAATTCTCAACAGTGGCTGAACAATTTCTTGATACAGGTT
TGTGAAACAACCGAATTTTTTTTTTTTTATAACACGTGAATCTTACTTTGAGGAAAACAGAATGTGCAACAATCA
GCTAAAGGGGAATTCAAGTCTATCCGCGACGGAGAGTTGACATTGGAAGATCGTTTCTCTTATCCGTTGAACATC
AATTTCAGTTATCTCAATGAGAATTTGACCGACTGTAAGTCTTGATATTCACTCGATGGCCGACCGAATTCTGAA
TTGAGTGAAGGGTTTACGACCTTTGATCATTCTTACGAACGAGATCTTCTTCCCATGCCCACCATCGTTCGAAGC
AAAACCAACAATCGCCAACTGGCAGGTACGTAATCATATGCAAAAGGGATCGAAAGTCGGGTTTGTTCAATGAAG
CACTCAGATGGATTTTTCCACCTTGCGCCTACGGGTAACACTGGCAATGGCACGAATAGCAACGTTTTTAGCTAC
AGCGACGAGGCCAAGAACACCTATAACAGAAAGGTCAATGCCGAGTTTAACAACATTACACTCGATGTCGAATCC
GGCAATCTTGCCCCAGCTCCGGCACCGTTGCCTCTTACAGACAGGTTGATCCCTCAGTCAGGCTACAGCAACCCC
AGACGTCCTGGCGTAAGGGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail