Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057220
Gene name
Locationscaffold_3:1114145..1116198
Strand-
Gene length (bp)2053
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 5.5E-130 60 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 39 376 6.0E-127
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 43 376 7.0E-123
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 67 378 2.0E-121
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 59 376 3.0E-118
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 5 376 4.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 39 376 6.0E-127
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 43 376 7.0E-123
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 67 378 2.0E-121
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 59 376 3.0E-118
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 5 376 4.0E-113
sp|O60160|OMH1_SCHPO O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh1 PE=3 SV=1 69 380 1.0E-110
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 68 376 4.0E-102
sp|P26725|YUR1_YEAST Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YUR1 PE=1 SV=1 59 376 7.0E-102
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 73 378 1.0E-101
sp|O42944|OMH2_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh2 PE=3 SV=1 73 376 1.0E-97
sp|P87207|MNT3_CANAL Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT3 PE=3 SV=1 61 376 2.0E-96
sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR4 PE=1 SV=1 71 357 1.0E-85
sp|O94565|OMH4_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh4 PE=3 SV=2 71 349 6.0E-80
sp|Q96WW1|OMH5_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh5 PE=3 SV=2 71 368 3.0E-75
sp|P54070|KTR6_YEAST Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR6 PE=1 SV=1 59 376 6.0E-69
sp|P40504|KTR7_YEAST Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR7 PE=1 SV=1 6 354 1.0E-67
sp|P53966|KTR5_YEAST Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR5 PE=1 SV=1 46 350 6.0E-62
sp|Q9P4X2|OMH6_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh6 PE=3 SV=1 76 359 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0006486 protein glycosylation Yes
GO:0016757 glycosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0043413 macromolecule glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 61.05 34.83 87.27
Initials Initials knots 38.47 22.15 54.79
Pileal_Stipeal_center Stage I stipe center 88.50 52.89 124.10
Pileal_Stipeal_shell Stage I stipe shell 116.10 68.62 163.58
DIF_stipe_center Stage II stipe center 117.78 70.65 164.91
DIF_stipe_shell Stage II stipe shell 94.50 56.20 132.79
DIF_stipe_skin Stage II stipe skin 99.38 59.51 139.25
DIF_cap_skin Stage II cap skin 166.24 98.95 233.52
DIF_cap_tissue Stage II cap tissue 158.62 94.14 223.11
DIF_gill_tissue Stage II gill tissue 127.45 76.63 178.28
YFB_stipe_center Young fruiting body stipe center 113.43 67.55 159.30
YFB_stipe_shell Young fruiting body stipe shell 103.88 62.54 145.22
YFB_stipe_skin Young fruiting body stipe skin 104.62 62.21 147.03
YFB_cap_skin Young fruiting body cap skin 166.33 99.19 233.48
YFB_cap_tissue Young fruiting body cap tissue 196.40 116.00 276.79
YFB_gill_tissue Young fruiting body gill tissue 118.90 71.49 166.31
YFB_veil Young fruiting body veil 120.84 72.41 169.27

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.004928 yes
Casing YFB_stipe_center 0.019987 yes
Casing YFB_stipe_shell 0.055779 no
Casing YFB_stipe_skin 0.055779 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.011041 yes
Casing YFB_veil 0.011041 yes
Casing Initials 0.125429 no
Casing Pileal_Stipeal_center 0.224812 no
Casing Pileal_Stipeal_shell 0.013485 yes
Casing DIF_stipe_center 0.012577 yes
Casing DIF_stipe_shell 0.139408 no
Casing DIF_stipe_skin 0.087080 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.791128 no
DIF_gill_tissue YFB_stipe_shell 0.557935 no
DIF_gill_tissue YFB_stipe_skin 0.590660 no
DIF_gill_tissue YFB_cap_skin 0.416662 no
DIF_gill_tissue YFB_cap_tissue 0.126023 no
DIF_gill_tissue YFB_gill_tissue 0.885220 no
DIF_gill_tissue YFB_veil 0.916523 no
YFB_stipe_center YFB_stipe_shell 0.853152 no
YFB_stipe_center YFB_stipe_skin 0.869333 no
YFB_stipe_center YFB_cap_skin 0.199136 no
YFB_stipe_center YFB_cap_tissue 0.043339 yes
YFB_stipe_center YFB_gill_tissue 0.929049 no
YFB_stipe_center YFB_veil 0.902444 no
YFB_stipe_shell YFB_stipe_skin 0.988920 no
YFB_stipe_shell YFB_cap_skin 0.087416 no
YFB_stipe_shell YFB_cap_tissue 0.012577 yes
YFB_stipe_shell YFB_gill_tissue 0.746452 no
YFB_stipe_shell YFB_veil 0.709185 no
YFB_stipe_skin YFB_cap_skin 0.094323 no
YFB_stipe_skin YFB_cap_tissue 0.016669 yes
YFB_stipe_skin YFB_gill_tissue 0.763653 no
YFB_stipe_skin YFB_veil 0.728662 no
YFB_cap_skin YFB_cap_tissue 0.683444 no
YFB_cap_skin YFB_gill_tissue 0.265551 no
YFB_cap_skin YFB_veil 0.305062 no
YFB_cap_tissue YFB_gill_tissue 0.070499 no
YFB_cap_tissue YFB_veil 0.081406 no
YFB_gill_tissue YFB_veil 0.976714 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.001625 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.201274 no
Pileal_Stipeal_center YFB_stipe_center 0.459057 no
Pileal_Stipeal_center YFB_stipe_shell 0.669124 no
Pileal_Stipeal_center YFB_stipe_skin 0.661865 no
Pileal_Stipeal_center YFB_cap_skin 0.012880 yes
Pileal_Stipeal_center YFB_cap_tissue 0.001140 yes
Pileal_Stipeal_center YFB_gill_tissue 0.333433 no
Pileal_Stipeal_center YFB_veil 0.305510 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.396660 no
Pileal_Stipeal_center DIF_stipe_center 0.356705 no
Pileal_Stipeal_center DIF_stipe_shell 0.893575 no
Pileal_Stipeal_center DIF_stipe_skin 0.785574 no
Pileal_Stipeal_center DIF_cap_skin 0.012274 yes
Pileal_Stipeal_center DIF_cap_tissue 0.027698 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.843180 no
Pileal_Stipeal_shell YFB_stipe_center 0.966527 no
Pileal_Stipeal_shell YFB_stipe_shell 0.798581 no
Pileal_Stipeal_shell YFB_stipe_skin 0.818978 no
Pileal_Stipeal_shell YFB_cap_skin 0.232315 no
Pileal_Stipeal_shell YFB_cap_tissue 0.058147 no
Pileal_Stipeal_shell YFB_gill_tissue 0.966069 no
Pileal_Stipeal_shell YFB_veil 0.941014 no
Pileal_Stipeal_shell DIF_stipe_center 0.979835 no
Pileal_Stipeal_shell DIF_stipe_shell 0.579205 no
Pileal_Stipeal_shell DIF_stipe_skin 0.697653 no
Pileal_Stipeal_shell DIF_cap_skin 0.233970 no
Pileal_Stipeal_shell DIF_cap_tissue 0.333349 no
DIF_stipe_center DIF_gill_tissue 0.870568 no
DIF_stipe_center YFB_stipe_center 0.943101 no
DIF_stipe_center YFB_stipe_shell 0.765142 no
DIF_stipe_center YFB_stipe_skin 0.786700 no
DIF_stipe_center YFB_cap_skin 0.251968 no
DIF_stipe_center YFB_cap_tissue 0.060104 no
DIF_stipe_center YFB_gill_tissue 0.985982 no
DIF_stipe_center YFB_veil 0.961758 no
DIF_stipe_center DIF_stipe_shell 0.539647 no
DIF_stipe_center DIF_stipe_skin 0.658255 no
DIF_stipe_center DIF_cap_skin 0.253365 no
DIF_stipe_center DIF_cap_tissue 0.360534 no
DIF_stipe_shell DIF_gill_tissue 0.348732 no
DIF_stipe_shell YFB_stipe_center 0.641031 no
DIF_stipe_shell YFB_stipe_shell 0.835968 no
DIF_stipe_shell YFB_stipe_skin 0.825275 no
DIF_stipe_shell YFB_cap_skin 0.035076 yes
DIF_stipe_shell YFB_cap_tissue 0.004160 yes
DIF_stipe_shell YFB_gill_tissue 0.511838 no
DIF_stipe_shell YFB_veil 0.473320 no
DIF_stipe_shell DIF_stipe_skin 0.923966 no
DIF_stipe_shell DIF_cap_skin 0.033674 yes
DIF_stipe_shell DIF_cap_tissue 0.059906 no
DIF_stipe_skin DIF_gill_tissue 0.469370 no
DIF_stipe_skin YFB_stipe_center 0.759404 no
DIF_stipe_skin YFB_stipe_shell 0.932721 no
DIF_stipe_skin YFB_stipe_skin 0.921552 no
DIF_stipe_skin YFB_cap_skin 0.054776 no
DIF_stipe_skin YFB_cap_tissue 0.008457 yes
DIF_stipe_skin YFB_gill_tissue 0.634566 no
DIF_stipe_skin YFB_veil 0.601639 no
DIF_stipe_skin DIF_cap_skin 0.052346 no
DIF_stipe_skin DIF_cap_tissue 0.094657 no
DIF_cap_skin DIF_gill_tissue 0.430255 no
DIF_cap_skin YFB_stipe_center 0.204111 no
DIF_cap_skin YFB_stipe_shell 0.087416 no
DIF_cap_skin YFB_stipe_skin 0.098442 no
DIF_cap_skin YFB_cap_skin 0.999036 no
DIF_cap_skin YFB_cap_tissue 0.681072 no
DIF_cap_skin YFB_gill_tissue 0.273250 no
DIF_cap_skin YFB_veil 0.310490 no
DIF_cap_skin DIF_cap_tissue 0.931369 no
DIF_cap_tissue DIF_gill_tissue 0.551053 no
DIF_cap_tissue YFB_stipe_center 0.291145 no
DIF_cap_tissue YFB_stipe_shell 0.139408 no
DIF_cap_tissue YFB_stipe_skin 0.155303 no
DIF_cap_tissue YFB_cap_skin 0.930143 no
DIF_cap_tissue YFB_cap_tissue 0.576383 no
DIF_cap_tissue YFB_gill_tissue 0.379285 no
DIF_cap_tissue YFB_veil 0.422734 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057220
MMTTMRYVLLVLVIIISLHYILSFSNETYGEVTSLNHVKQIIGVGNEPPYKTAISEEYYIKPNVSVAEGRRANAA
IVILARNSDIDGVVDSVKQMEDRFNKKFRYDYVLLNEQPFEDKFKYRLEQLTDSTIKYGLIPPEHWVQPDWIDEE
KASAARKDMVKNNVIYGGSVPYRNMCRFNSGFFYRQEILKPYKYYWRVEPGVKFFCDIDYDPFIFMEDKKKVYGF
TISLFEYKETIPTLWNTVKDFIKQNPDFVAPGNSMQFLSDNNGEDYNLCHFWSNFEIGDLDFWRGEAYSKFFDHL
DQAGGFYYERWGDAPVHSIGAALFAQKEQIHFFNDIGYRHEPFQHCPQGSAHKQGKCWCDEKVNFDYEWYSCLKR
YDEMFA*
Coding >AgabiH97|057220
ATGATGACGACCATGCGATACGTCCTGTTGGTCCTGGTCATAATCATCAGTCTTCACTATATCCTGAGTTTCTCG
AATGAAACATATGGAGAGGTGACGTCCTTGAACCACGTCAAACAAATTATAGGTGTAGGAAACGAGCCACCGTAC
AAAACTGCAATCTCCGAAGAGTATTATATCAAACCCAATGTATCTGTAGCGGAGGGGCGGAGGGCGAATGCTGCC
ATTGTCATACTTGCTCGGAACTCTGATATTGATGGAGTTGTCGACAGTGTTAAGCAAATGGAGGACAGATTCAAC
AAGAAGTTTAGATATGACTATGTGTTGCTCAATGAGCAACCTTTCGAGGATAAATTTAAGTACCGACTCGAGCAA
TTGACGGATTCTACAATAAAATATGGCCTTATTCCTCCTGAGCATTGGGTCCAGCCGGATTGGATTGACGAGGAG
AAGGCATCCGCAGCAAGGAAAGACATGGTTAAGAATAATGTAATCTACGGAGGCAGTGTCCCATACCGGAACATG
TGTCGCTTCAACTCTGGATTTTTCTATAGACAAGAAATTCTCAAGCCGTACAAATATTACTGGAGGGTTGAACCC
GGTGTCAAGTTTTTCTGTGATATTGACTATGATCCATTCATTTTCATGGAAGACAAGAAAAAAGTTTACGGATTT
ACAATCTCACTTTTCGAATACAAGGAAACAATACCAACGCTCTGGAACACCGTCAAAGATTTCATCAAACAAAAT
CCAGACTTCGTAGCGCCCGGAAACTCGATGCAATTCTTGTCTGATAACAACGGCGAGGATTACAATCTCTGCCAT
TTCTGGAGCAACTTTGAGATTGGTGACCTGGACTTTTGGAGGGGAGAGGCGTATTCCAAGTTCTTTGATCATTTG
GATCAAGCTGGTGGATTCTATTACGAGCGCTGGGGTGATGCTCCTGTCCATAGCATTGGTGCCGCCCTATTTGCA
CAGAAGGAACAGATTCACTTTTTCAATGATATCGGCTATCGTCATGAGCCTTTCCAACATTGCCCTCAAGGTAGT
GCCCACAAGCAAGGTAAATGTTGGTGTGACGAGAAAGTGAACTTTGACTATGAGTGGTACTCTTGCCTGAAGCGC
TACGATGAAATGTTTGCATAA
Transcript >AgabiH97|057220
ATGATGACGACCATGCGATACGTCCTGTTGGTCCTGGTCATAATCATCAGTCTTCACTATATCCTGAGTTTCTCG
AATGAAACATATGGAGAGGTGACGTCCTTGAACCACGTCAAACAAATTATAGGTGTAGGAAACGAGCCACCGTAC
AAAACTGCAATCTCCGAAGAGTATTATATCAAACCCAATGTATCTGTAGCGGAGGGGCGGAGGGCGAATGCTGCC
ATTGTCATACTTGCTCGGAACTCTGATATTGATGGAGTTGTCGACAGTGTTAAGCAAATGGAGGACAGATTCAAC
AAGAAGTTTAGATATGACTATGTGTTGCTCAATGAGCAACCTTTCGAGGATAAATTTAAGTACCGACTCGAGCAA
TTGACGGATTCTACAATAAAATATGGCCTTATTCCTCCTGAGCATTGGGTCCAGCCGGATTGGATTGACGAGGAG
AAGGCATCCGCAGCAAGGAAAGACATGGTTAAGAATAATGTAATCTACGGAGGCAGTGTCCCATACCGGAACATG
TGTCGCTTCAACTCTGGATTTTTCTATAGACAAGAAATTCTCAAGCCGTACAAATATTACTGGAGGGTTGAACCC
GGTGTCAAGTTTTTCTGTGATATTGACTATGATCCATTCATTTTCATGGAAGACAAGAAAAAAGTTTACGGATTT
ACAATCTCACTTTTCGAATACAAGGAAACAATACCAACGCTCTGGAACACCGTCAAAGATTTCATCAAACAAAAT
CCAGACTTCGTAGCGCCCGGAAACTCGATGCAATTCTTGTCTGATAACAACGGCGAGGATTACAATCTCTGCCAT
TTCTGGAGCAACTTTGAGATTGGTGACCTGGACTTTTGGAGGGGAGAGGCGTATTCCAAGTTCTTTGATCATTTG
GATCAAGCTGGTGGATTCTATTACGAGCGCTGGGGTGATGCTCCTGTCCATAGCATTGGTGCCGCCCTATTTGCA
CAGAAGGAACAGATTCACTTTTTCAATGATATCGGCTATCGTCATGAGCCTTTCCAACATTGCCCTCAAGGTAGT
GCCCACAAGCAAGGTAAATGTTGGTGTGACGAGAAAGTGAACTTTGACTATGAGTGGTACTCTTGCCTGAAGCGC
TACGATGAAATGTTTGCATAA
Gene >AgabiH97|057220
ATGATGACGACCATGCGATACGTCCTGTTGGTCCTGGTCATAATCGTAAGTCTCCACTTAGATTCCGAGTTTCAG
GTGTTCCGCCAACCTTGGTTTAACAGATCAGTCTTCACTATATCCTGAGTTTCTCGAATGAAACATATGGAGAGG
TGACGTCCTTGAACCACGTCAAACAAATTATAGGTGTAGGAAACGAGCCACCGTACAAAACTGCAATCTCCGAAG
AGTATTATATCAAACCCAATGTATCTGTAGCGGAGGGGCGGAGGGCGAATGCTGCCATTGTCATACTTGGTGCGT
TCCCATGCCTATGCTTTAAAGAACTTTACCTCTGAAGATGATCATCGTTTAGCTCGGAACTCTGATATTGATGGA
GTTGTCGACAGTGTTAAGCAAATGGAGGACAGATTCAACAAGAAGTTTAGATATGACTATGTGTTGCTCAATGAG
CAACCTTTCGAGGATAAATTTAAGTAGTACGTCCACGGTCCACCGTCTTTCCATTTGCATCAATTCTTTTGGTCG
TTGCTAACGTGTTGCATTCCTTGGCGTACTGCTGATTCAGCCGACTCGAGCAATTGACGGATTCTACAATAAAAT
ATGGCCTTATTCCTCCTGAGCATTGGGTCCAGCCGGATTGGATTGACGAGGAGAAGGCATCCGCAGCAAGGAAAG
ACATGGTTAAGAATAATGTAATCTACGGAGGTGCGTTCATAAGTATGTTGAGGTGTGATGTTCTGATACTCATCT
CGTTCTAAAGGCAGTGTCCCGTACGTTGATATGTGTTTTTATCATTTTGCTGATTTTGAGTCTTTGCCCAAAGAT
ACCGGAACATGTGTCGCTTCAACTCTGGAGTATGTTGCATTTCTTTTGTCATTTTGTGCCCTGTGAATGACAGAA
CTATTTAGTTTTTCTATAGACAAGAAATTCTCAAGCCGTACAAATATTACTGGAGGTACGTTCGACAATTGCGTC
AACGGAAAGTTGTTTAACGTATATGTCTTCGACAGGGTTGAGTGAGTGTCAAAACAAAGTACACCGCCTTGCATA
TTCTCAAGACGAATTCTTCTTTCAATAGACCCGGTGTCAAGTTTTTCTGTGATATTGACTATGATCCATTCATTT
TCATGGAAGACAAGAAAAAAGTTTACGGTGAGCTAACCAACTGACTCTGAATTATGAATATAAAATCTCAATCTC
CTATCTAGGATTTACAATCTCACTTTTCGAATACAAGGAAACAATACCAACGCTCTGGAACACCGTCAAAGGTAC
GAAAAGCTCGACCTGGACCTTAGATATAGACGCTTACGTTGGGCAAATAACAAAATTATAGATTTCATCAAACAA
AATCCAGACTTCGTAGCGCCCGGAAACTCGATGCAATTCTTGTCTGATAACAACGGCGAGGATTACAATCTCTGC
CATTGTAAGTATCTTTTCAGCATAATCCCCTGTGTATAAGTATTACCCTAACGACATTATTAGTCTGGAGCAACT
TTGAGATTGGTGACCTGGACTTTTGGAGGGGAGAGGCGTATTCCAAGTTCTTTGATCATTTGGATCAAGCTGGTG
GATTCTATTACGAGGTAAGGCAACACTTTTACTGGACTAAATAAGAATATCCGGTTGACGGTATCGTTACCTTAG
CGCTGGGGTGATGCTCCTGTCCATAGCATTGGTGCCGCCCTATTTGCACAGAAGGAACAGATTGTAAGTATTCAT
TACCAAAAAAAACTTTCCGTCTCCCAGCACTGATCAAATACAACGTCCAATAGCACTTTTTCAATGATATCGGTG
AGTTCAATTCAATTCAATTCTTTTATATTTTTTGCTCAAAAATGTTTTGCAGGCTATCGTCATGAGCCTTTCCAA
CATTGCCCTCAAGGTAGTGCCCACAAGCAAGGTAAATGTTGGTGTGACGAGAAAGTGAACTTTGGTGAGTCAACC
CCTATTATCTCGTCCTTCAGCAATGCCTGATATACTTTTCCCCTATCAACAAGACTATGAGTGGTACTCTTGCCT
GAAGCGCTACGATGAAATGTTTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail