Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057210
Gene name
Locationscaffold_3:1110134..1113933
Strand+
Gene length (bp)3799
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 8.0E-33 817 1026

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 793 1086 1.0E-96
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 713 1086 2.0E-94
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 785 1087 1.0E-90
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 785 1087 2.0E-90
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 785 1087 3.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 793 1086 1.0E-96
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 713 1086 2.0E-94
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 785 1087 1.0E-90
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 785 1087 2.0E-90
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 785 1087 3.0E-90
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 793 1086 5.0E-90
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 785 1087 6.0E-90
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 785 1087 6.0E-90
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 785 1087 6.0E-90
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 785 1087 6.0E-90
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 785 1087 7.0E-90
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 785 1087 8.0E-90
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 785 1087 9.0E-90
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 785 1087 4.0E-89
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 785 1087 6.0E-89
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 785 1087 3.0E-87
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 791 1086 1.0E-82
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 781 1086 1.0E-80
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 793 1087 1.0E-69
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 793 1080 7.0E-67
sp|P37297|STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT4 PE=1 SV=1 818 1086 2.0E-48
sp|O02811|PI4KA_BOVIN Phosphatidylinositol 4-kinase alpha OS=Bos taurus GN=PI4KA PE=2 SV=1 809 1086 4.0E-47
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens GN=PI4KA PE=1 SV=3 809 1086 6.0E-47
sp|O08662|PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus GN=Pi4ka PE=1 SV=1 818 1086 1.0E-46
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 818 1086 1.0E-46
sp|A4QPH2|PI4P2_HUMAN Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens GN=PI4KAP2 PE=5 SV=3 829 1086 1.0E-39
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 819 1086 2.0E-37
sp|Q9SXA1|P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana GN=PI4KA1 PE=1 SV=2 818 1086 1.0E-32
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 19 465 4.0E-30
sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum GN=pikC PE=2 SV=2 817 1070 6.0E-29
sp|O70167|P3C2G_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Mus musculus GN=Pik3c2g PE=2 SV=1 817 1068 7.0E-29
sp|Q9C680|P4KA2_ARATH Phosphatidylinositol 4-kinase alpha 2 OS=Arabidopsis thaliana GN=PI4KA2 PE=1 SV=1 818 1086 1.0E-27
sp|Q61194|P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus GN=Pik3c2a PE=1 SV=2 776 1075 1.0E-27
sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2 775 1075 3.0E-27
sp|Q5RAY1|P3C2A_PONAB Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Pongo abelii GN=PIK3C2A PE=2 SV=1 787 1075 1.0E-26
sp|O70173|P3C2G_RAT Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus GN=Pik3c2g PE=2 SV=1 817 1049 2.0E-26
sp|O75747|P3C2G_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens GN=PIK3C2G PE=1 SV=3 817 1012 2.0E-26
sp|P54673|PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum GN=pikA PE=2 SV=2 813 1085 7.0E-26
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum GN=pikB PE=2 SV=2 817 1084 2.0E-25
sp|O00750|P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens GN=PIK3C2B PE=1 SV=2 774 1075 3.0E-25
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 331 496 6.0E-25
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform OS=Glycine max PE=2 SV=1 812 1084 1.0E-24
sp|P54676|PI3K4_DICDI Phosphatidylinositol 3-kinase VPS34-like OS=Dictyostelium discoideum GN=pikE PE=3 SV=2 819 1052 2.0E-24
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform OS=Glycine max PE=2 SV=1 812 1084 3.0E-24
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 783 1079 3.0E-24
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 708 1084 1.0E-23
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 819 1077 3.0E-23
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 298 458 4.0E-23
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 815 1073 4.0E-23
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 802 1079 4.0E-23
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 708 1084 4.0E-23
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 708 1084 4.0E-23
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 815 1073 5.0E-23
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 815 1079 6.0E-23
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 708 1084 7.0E-23
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 799 1084 2.0E-22
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 817 1084 2.0E-22
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 817 1045 5.0E-22
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 815 1073 5.0E-22
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 817 1045 6.0E-22
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 819 1070 5.0E-21
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 335 455 2.0E-20
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 819 1023 1.0E-17
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 819 1023 1.0E-17
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 819 1077 2.0E-17
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 2 207 7.0E-17
sp|P0C5E7|AGE1_CAEBR Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis briggsae GN=age-1 PE=3 SV=1 819 1008 7.0E-17
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 818 1023 1.0E-16
sp|Q92213|VPS34_CANAX Phosphatidylinositol 3-kinase VPS34 OS=Candida albicans GN=VPS34 PE=3 SV=1 921 1082 6.0E-13
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 7 190 1.0E-12
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 307 438 7.0E-11
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 7 190 2.0E-09
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 823 1026 4.0E-09
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 899 1026 3.0E-08
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 899 1026 3.0E-08
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 853 1026 4.0E-08
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 820 1026 2.0E-07
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 346 447 3.0E-07
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 346 447 4.0E-07
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 346 447 4.0E-07
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 346 445 4.0E-07
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 346 445 4.0E-07
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 348 438 4.0E-07
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 346 445 4.0E-07
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 346 438 4.0E-07
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 823 1067 4.0E-07
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 346 445 5.0E-07
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 346 438 6.0E-07
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 820 993 1.0E-06
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 797 1026 1.0E-06
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 866 1084 2.0E-06
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 820 1029 2.0E-06
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 820 1038 3.0E-06
sp|Q8SR56|VPS34_ENCCU Probable phosphatidylinositol 3-kinase VPS34 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=VPS34 PE=3 SV=2 819 1019 3.0E-06
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 910 1029 5.0E-06
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 910 1029 5.0E-06
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 922 1038 6.0E-06
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 922 1038 6.0E-06
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 910 1029 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057210
MASHALLLRLFLSPSFFSLHLALNYLRLYADNVGITYYLTRRLRELDVHQLYDVWGFICHLLVTRPSKSRALEVF
VVETAQRSTHIAMITLWYMQASLHDLSLTRRESPSFTICQRVLHKCHEIIFNDLPRPTSSPYPPFKLSARGSFAR
RRIRHHAEPAFVGMGVILAAAPAMPALADFTGQIALEQGRADDDGQELRSLRSIETDLVLVTAPKTADSSGIDDD
MDPETDSPPNEESGLSQADNHEPLRQDAPIILRRRTVTAAQTVPALPLHLRTIRRSRASEDPLGQLDYETLPAAP
AQSSPALPATRTPPRFAAAKMADGLLEKYDLQAQTQLLRGHYCHSEVQFILDLENLCNRLLIVPKPARVSALRAE
LTALNHKLPAEVCMPMWCNSSDIPQGPNNIPKPHHRIVRIPPGESVVLNSAERAPYLLLIEIIHDDLDFDPSKRA
NKEVLRKIVSKEEEKKGASNDLVSFGRSKSKQSDAQTGTEGGDLTVDTDIPHSSLPIPVPYESFPPPDTLRSAES
DNPEEEIDLVEQLYGAEQPLRSANLDLAESIVLPPAPKNRDLDMAAWSSTANVDDTGTPRRNSAPRTPIGNGNAD
SSDKSTLPPIGQVNGAYGVLSLDEYFERMRTAAIMLAQLNANLVRDQAATTYSSPPGSLSSTAQDVSSPSSSSSM
TAWIPGSGWLMGSSPLTSDASQPSPSGAAQGRMRLQHAQAQQIRDRIMKEMLALEEERMERMKENGSGFENGISW
NRAGLGIRGVDLGSASGENSVEDEGIIRRELNKADPSAVVFSESWATKKSRIKAASPYGHLANWDCVSVIVKTGG
DLRQEQLAVQLIQEFQRIWTEENCPCWVRYFRIVILGAASGLVETITDAVSIHSIKKAEYAKRLARNRLGYVTLM
DHFKSAYGDPSSAKFARAQRNFAKSLAGYSIITYLLQVKDRHNGNILLDREGHLIHIDFGFILSNTPGNIGFEAA
PFKLPLEYIEVLGGENGVPFMEFKRLFREGFEAARKHCDRILTLVELMQRDSTLPCFALYGEQTVQYLKDRFQPT
LTHSLIGEYVDRLIDTSLGSHWTRLYDSYQYYSQSIL*
Coding >AgabiH97|057210
ATGGCCTCGCATGCGCTCCTCCTGCGCCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTT
GTCGTCGAGACTGCCCAGCGTTCCACCCACATCGCCATGATCACACTCTGGTACATGCAAGCCTCCCTCCACGAT
CTTTCATTGACCCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGGGTCCTCCACAAATGCCATGAGATCATC
TTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAATTATCCGCCCGGGGTTCCTTTGCTCGG
AGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTCATTCTCGCTGCAGCCCCTGCCATGCCT
GCCCTCGCTGACTTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCCGATGACGATGGACAAGAGCTGCGTAGC
CTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACAGCAGACTCCTCTGGCATAGACGACGAC
ATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAGTGGTCTCTCCCAGGCAGATAATCACGAGCCATTACGG
CAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCCGCCCAAACAGTACCCGCTTTACCACTACACCTA
CGTACAATTCGACGCTCCCGAGCCTCCGAAGATCCTCTTGGACAGTTGGATTATGAAACCTTGCCGGCTGCCCCC
GCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTTGCTGCTGCTAAGATGGCCGATGGGCTT
CTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCACTACTGTCATTCGGAAGTCCAATTCATC
CTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCAGAA
CTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAG
GGTCCCAACAACATACCCAAACCCCATCATCGCATAGTCAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCT
GCGGAACGAGCCCCATACCTGTTACTAATCGAAATCATACACGACGACCTCGATTTTGATCCTTCTAAACGAGCT
AATAAAGAGGTACTCAGGAAGATAGTGTCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTT
GGCCGCAGTAAATCCAAACAGTCGGATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATC
CCTCACTCCTCCCTCCCCATCCCAGTACCATACGAGTCGTTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCA
GATAACCCGGAAGAGGAAATTGACCTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACCTA
GACCTGGCAGAATCGATCGTACTGCCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACC
GCAAATGTAGATGACACCGGAACCCCAAGGAGGAACTCGGCCCCAAGAACTCCGATCGGTAATGGGAACGCAGAC
TCATCTGACAAAAGCACGCTGCCGCCTATTGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTAT
TTTGAGCGAATGCGGACAGCCGCGATCATGCTCGCGCAGCTCAATGCAAATCTAGTTCGTGACCAGGCGGCCACA
ACTTACTCCTCGCCTCCCGGTAGTCTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATG
ACTGCCTGGATTCCCGGTTCGGGTTGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCG
TCCGGCGCGGCACAGGGACGAATGCGACTTCAGCATGCCCAAGCTCAACAAATCAGGGACAGAATAATGAAAGAG
ATGTTGGCGCTCGAAGAGGAGCGGATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGGATCAGTTGG
AATAGAGCAGGCCTTGGAATCAGGGGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGT
ATTATCAGGCGGGAATTGAATAAAGCCGATCCATCCGCTGTGGTCTTTAGCGAGAGCTGGGCTACTAAGAAAAGT
CGGATAAAAGCGGCATCGCCTTATGGACATCTCGCGAATTGGGATTGTGTGTCTGTAATAGTCAAAACTGGCGGT
GATTTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATGGACTGAAGAGAATTGTCCG
TGCTGGGTGCGATACTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTA
TCAATACATTCCATCAAAAAGGCAGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATG
GACCACTTCAAGTCTGCTTATGGTGATCCGTCTTCTGCCAAGTTCGCTCGTGCCCAACGCAATTTTGCAAAGTCT
CTTGCTGGATATTCCATCATTACTTACCTTTTACAAGTGAAAGATCGGCATAATGGCAATATTCTTCTTGACAGA
GAAGGCCACCTTATCCATATTGACTTTGGATTTATTCTTAGTAATACACCGGGCAATATTGGGTTTGAAGCTGCG
CCGTTCAAGTTGCCGTTGGAGTATATTGAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTCAAAAGG
TTGTTCAGGGAAGGGTTTGAAGCTGCTAGGAAACATTGCGATCGGATACTTACACTAGTAGAACTGATGCAGAGA
GACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGCAATACTTGAAGGACAGGTTTCAACCTACA
TTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATACGTCTTTGGGCTCTCACTGGACGAGGCTT
TATGATTCTTATCAGTATTATTCGCAGTCCATTCTATGA
Transcript >AgabiH97|057210
ATGGCCTCGCATGCGCTCCTCCTGCGCCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTT
GTCGTCGAGACTGCCCAGCGTTCCACCCACATCGCCATGATCACACTCTGGTACATGCAAGCCTCCCTCCACGAT
CTTTCATTGACCCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGGGTCCTCCACAAATGCCATGAGATCATC
TTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAATTATCCGCCCGGGGTTCCTTTGCTCGG
AGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTCATTCTCGCTGCAGCCCCTGCCATGCCT
GCCCTCGCTGACTTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCCGATGACGATGGACAAGAGCTGCGTAGC
CTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACAGCAGACTCCTCTGGCATAGACGACGAC
ATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAGTGGTCTCTCCCAGGCAGATAATCACGAGCCATTACGG
CAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCCGCCCAAACAGTACCCGCTTTACCACTACACCTA
CGTACAATTCGACGCTCCCGAGCCTCCGAAGATCCTCTTGGACAGTTGGATTATGAAACCTTGCCGGCTGCCCCC
GCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTTGCTGCTGCTAAGATGGCCGATGGGCTT
CTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCACTACTGTCATTCGGAAGTCCAATTCATC
CTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCAGAA
CTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAG
GGTCCCAACAACATACCCAAACCCCATCATCGCATAGTCAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCT
GCGGAACGAGCCCCATACCTGTTACTAATCGAAATCATACACGACGACCTCGATTTTGATCCTTCTAAACGAGCT
AATAAAGAGGTACTCAGGAAGATAGTGTCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTT
GGCCGCAGTAAATCCAAACAGTCGGATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATC
CCTCACTCCTCCCTCCCCATCCCAGTACCATACGAGTCGTTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCA
GATAACCCGGAAGAGGAAATTGACCTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACCTA
GACCTGGCAGAATCGATCGTACTGCCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACC
GCAAATGTAGATGACACCGGAACCCCAAGGAGGAACTCGGCCCCAAGAACTCCGATCGGTAATGGGAACGCAGAC
TCATCTGACAAAAGCACGCTGCCGCCTATTGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTAT
TTTGAGCGAATGCGGACAGCCGCGATCATGCTCGCGCAGCTCAATGCAAATCTAGTTCGTGACCAGGCGGCCACA
ACTTACTCCTCGCCTCCCGGTAGTCTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATG
ACTGCCTGGATTCCCGGTTCGGGTTGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCG
TCCGGCGCGGCACAGGGACGAATGCGACTTCAGCATGCCCAAGCTCAACAAATCAGGGACAGAATAATGAAAGAG
ATGTTGGCGCTCGAAGAGGAGCGGATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGGATCAGTTGG
AATAGAGCAGGCCTTGGAATCAGGGGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGT
ATTATCAGGCGGGAATTGAATAAAGCCGATCCATCCGCTGTGGTCTTTAGCGAGAGCTGGGCTACTAAGAAAAGT
CGGATAAAAGCGGCATCGCCTTATGGACATCTCGCGAATTGGGATTGTGTGTCTGTAATAGTCAAAACTGGCGGT
GATTTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATGGACTGAAGAGAATTGTCCG
TGCTGGGTGCGATACTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTA
TCAATACATTCCATCAAAAAGGCAGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATG
GACCACTTCAAGTCTGCTTATGGTGATCCGTCTTCTGCCAAGTTCGCTCGTGCCCAACGCAATTTTGCAAAGTCT
CTTGCTGGATATTCCATCATTACTTACCTTTTACAAGTGAAAGATCGGCATAATGGCAATATTCTTCTTGACAGA
GAAGGCCACCTTATCCATATTGACTTTGGATTTATTCTTAGTAATACACCGGGCAATATTGGGTTTGAAGCTGCG
CCGTTCAAGTTGCCGTTGGAGTATATTGAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTCAAAAGG
TTGTTCAGGGAAGGGTTTGAAGCTGCTAGGAAACATTGCGATCGGATACTTACACTAGTAGAACTGATGCAGAGA
GACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGCAATACTTGAAGGACAGGTTTCAACCTACA
TTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATACGTCTTTGGGCTCTCACTGGACGAGGCTT
TATGATTCTTATCAGTATTATTCGCAGTCCATTCTATGA
Gene >AgabiH97|057210
ATGGCCTCGCATGCGCTCCTCCTGCGCCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGGTCCTCTTCTTCTCTCCCCGCCCTCACCACCCCGCTCACCCCCCTTCCT
ACAGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTTGTCGTCGAGACTGCCCAGCGTT
CCACCCACATCGCCATGATCGTACGTCTTTTCTCCTCCAATATTCACCTACTGTATACCCTTTTAGACACTCTGG
TACATGCAAGCCTCCCTCCACGATCTTTCATTGACCCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGGGTC
CTCCACAAATGCCATGAGATCATCTTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAATTA
TCCGCCCGGGGTTCCTTTGCTCGGAGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTCATT
CTCGCTGCAGCCCCTGCCATGCCTGCCCTCGCTGACTTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCCGAT
GACGATGGACAAGAGCTGCGTAGCCTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACAGCA
GACTCCTCTGGCATAGACGACGACATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAGTGGTCTCTCCCAG
GCAGATAATCACGAGCCATTACGGCAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCCGCCCAAACA
GTACCCGCTTTACCACTACACCTACGTACAATTCGACGCTCCCGAGCCTCCGAAGATCCTCTTGGACAGTTGGAT
TATGAAACCTTGCCGGCTGCCCCCGCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTTGCT
GCTGCTAAGATGGCCGATGGGCTTCTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCACTAC
TGTCATTCGGAAGTACGTCGATCATGTTTGACTATTTTTAGCCCAATCAATAATTATAATCAGGTCCAATTCATC
CTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCAGAA
CTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGACTTATACTATATTCAAGTCTGAGGCTCTTATAGATT
TTTCCTCAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAGGGTCCCAACAACATACCCAAACCC
CATCATCGCATAGTCAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCTGCGGAACGAGCCCCATACCTGTTA
CTAATCGAAATCATACACGACGACCTCGATTTTGATCCTTCTAAACGAGCTAATAAAGAGGTACTCAGGAAGATA
GTGTCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTTGGCCGCAGTAAATCCAAACAGTCG
GATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATCCCTCACTCCTCCCTCCCCATCCCA
GTACCATACGAGTCGTTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCAGATAACCCGGAAGAGGAAATTGAC
CTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACCTAGACCTGGCAGAATCGATCGTACTG
CCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACCGCAAATGTAGATGACACCGGAACC
CCAAGGAGGAACTCGGCCCCAAGAACTCCGATCGGTAATGGGAACGCAGACTCATCTGACAAAAGCACGCTGCCG
CCTATTGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTATTTTGAGCGAATGCGGACAGCCGCG
ATCATGCTCGCGCAGCTCAATGCAAATCTAGTTCGTGACCAGGCGGCCACAACTTACTCCTCGCCTCCCGGTAGT
CTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATGACTGCCTGGATTCCCGGTTCGGGT
TGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCGTCCGGCGCGGCACAGGGACGAATG
CGACTTCAGCATGCCCAAGCTCAACAAATCAGGGACAGAATAATGAAAGAGATGTTGGCGCTCGAAGAGGAGCGG
ATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGGATCAGTTGGAATAGAGCAGGCCTTGGAATCAGG
GGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGTATTATCAGGCGGGAATTGAATAAA
GCCGATCCATCCGCTGTGGTCTTTAGCGAGAGCTGGGCTACTAAGAAAGTGCGTTCAGGCCATTGTTATCGCTTA
CTCGACTGAGCGCATTTGTATAGAGTCGGATAAAAGCGGCATCGCCTTATGGACATCTCGGTGCGTATGCCGACT
CGGTCGATCATAACCTAAATTGACGCTTCCTGTCACTTCCAATTCTTAAGCGAATTGGGATTGTGTGTCTGTAAT
AGTCAAAACTGGCGGTGATTTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATGGAC
TGAAGAGAATTGTCCGTGCTGGGTGCGATAGTACGTTTTCTAGTTGGTTCAAACTGCGTTTGAGTAATTAACCTT
GTTGTCCAGCTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTATCAAT
ACATTCCATCAAAAAGGCAGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATGGACCA
CTTCAAGTCTGTAAGTCAAACTCGCAGCACTGGAATCGTCATTAACTTTTTCAATAATATAAGGCTTATGGTGAT
CCGTCTTCTGCCAAGTTCGCTCGTGCCCAACGCAATTTTGCAAAGTCTCTTGCTGGATATTCCATCATTACTTAC
CTTTTACAAGTGAAAGATCGGCATAATGGCAATATTCTTCTTGACAGAGAAGGCCACCTTATCCATATTGACTTT
GGATTTATTCTTAGTAATACACCGGGCAATATTGGGTTTGAAGCTGCGCCGTTCAAGTTGCCGTTGGAGTATATT
GAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTCAAAAGGTTGTTCAGGGAAGGGTTTGAAGCTGCT
AGGAAACATTGCGATCGGATACTTAGTAAGTCTTTCAAAGAAAAAAAGACTGAATATTTGGCTGAAACAATTATG
TAGCACTAGTAGAACTGATGCAGAGAGACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGCAAT
ACTTGAAGGACAGGTTTCAACCTACATTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATACGT
CTTTGGGCTCTCACTGGACGAGGCTTTATGATTCTGTGAGTATTCAAGTGTGTTCATTTGTTATTGTGACGCCCA
ATGTTGATGGCATGATTAGTATCAGTATTATTCGCAGTCCATTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail