Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057200
Gene name
Locationscaffold_3:1108922..1110053
Strand-
Gene length (bp)1131
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 1.0E-90 22 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH3|OST3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost3 PE=3 SV=1 29 310 2.0E-27
sp|Q63ZR0|MAGT1_XENLA Magnesium transporter protein 1 OS=Xenopus laevis GN=magt1 PE=2 SV=1 18 310 2.0E-26
sp|P34669|OST3_CAEEL Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Caenorhabditis elegans GN=ZK686.3 PE=3 SV=2 3 306 5.0E-26
sp|Q9CQY5|MAGT1_MOUSE Magnesium transporter protein 1 OS=Mus musculus GN=Magt1 PE=1 SV=1 22 310 3.0E-25
sp|Q9H0U3|MAGT1_HUMAN Magnesium transporter protein 1 OS=Homo sapiens GN=MAGT1 PE=1 SV=1 22 310 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH3|OST3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost3 PE=3 SV=1 29 310 2.0E-27
sp|Q63ZR0|MAGT1_XENLA Magnesium transporter protein 1 OS=Xenopus laevis GN=magt1 PE=2 SV=1 18 310 2.0E-26
sp|P34669|OST3_CAEEL Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Caenorhabditis elegans GN=ZK686.3 PE=3 SV=2 3 306 5.0E-26
sp|Q9CQY5|MAGT1_MOUSE Magnesium transporter protein 1 OS=Mus musculus GN=Magt1 PE=1 SV=1 22 310 3.0E-25
sp|Q9H0U3|MAGT1_HUMAN Magnesium transporter protein 1 OS=Homo sapiens GN=MAGT1 PE=1 SV=1 22 310 1.0E-24
sp|Q5ZJ06|MAGT1_CHICK Magnesium transporter protein 1 OS=Gallus gallus GN=MAGT1 PE=2 SV=1 18 310 1.0E-24
sp|Q5RE31|MAGT1_PONAB Magnesium transporter protein 1 OS=Pongo abelii GN=MAGT1 PE=2 SV=1 22 310 5.0E-24
sp|O35777|MAGT1_RAT Magnesium transporter protein 1 OS=Rattus norvegicus GN=Magt1 PE=2 SV=2 21 310 5.0E-24
sp|Q7ZV50|MAGT1_DANRE Magnesium transporter protein 1 OS=Danio rerio GN=magt1 PE=1 SV=1 16 306 4.0E-23
sp|Q8BTV1|TUSC3_MOUSE Tumor suppressor candidate 3 OS=Mus musculus GN=Tusc3 PE=1 SV=1 16 310 7.0E-19
sp|Q13454|TUSC3_HUMAN Tumor suppressor candidate 3 OS=Homo sapiens GN=TUSC3 PE=1 SV=1 16 306 3.0E-18
sp|Q32L57|TUSC3_BOVIN Tumor suppressor candidate 3 OS=Bos taurus GN=TUSC3 PE=2 SV=1 16 310 1.0E-17
sp|P48439|OST3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST3 PE=1 SV=1 22 308 9.0E-10
sp|Q03723|OST6_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST6 PE=1 SV=1 62 305 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 170 192 22
2 199 218 19
3 245 267 22
4 280 299 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057200
MLLRALVLPFLALAALAADPVEQLSQLASRGNGNIKLDTRGFDLITSPKRTWSVTIQLTALSQRHKCTMCKEFLP
AWNAVVRAWTSVPQPERDNHFFATLDFDDAPGVFQKLGLVAAPVVFTWAPAEGDRKSANTLPDKYDFNEGFGAGP
FADSVSRHTPVKIPYREPIDWTRLILTCIFGLSLLLALRFASPLFQSRWTWALGTISTSLIMTSGYMFTKIRNMP
YVGANGWIASGFQSQYGQEVHVVAFIYGLLSFSFLMLIFVVPNQKSPARQRAQVYLWSAVIVIIYSVLISLFRLK
NRGYPFKLFI*
Coding >AgabiH97|057200
ATGCTCCTCCGCGCCCTCGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCCGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCCGAGGTTTCGACCTCATCACCAGCCCAAAGCGC
ACATGGTCAGTCACTATCCAGCTCACCGCGCTCAGTCAGCGTCATAAATGCACGATGTGCAAGGAATTTCTGCCA
GCGTGGAATGCTGTCGTGCGCGCGTGGACCTCGGTGCCCCAACCCGAGCGTGACAATCACTTCTTTGCCACTCTC
GACTTTGATGACGCTCCTGGCGTGTTCCAAAAGCTCGGTCTCGTAGCTGCACCCGTCGTGTTTACCTGGGCACCT
GCCGAAGGCGATCGCAAGTCTGCCAATACCCTCCCTGACAAATATGATTTCAACGAAGGCTTCGGTGCGGGTCCC
TTTGCTGATTCCGTTTCGAGGCATACTCCCGTCAAAATTCCCTACCGCGAACCCATCGACTGGACACGCCTCATT
CTCACCTGCATCTTTGGTCTTTCCCTTTTACTCGCCCTCCGTTTCGCTTCTCCTCTTTTCCAGTCCCGCTGGACA
TGGGCTTTGGGAACCATCTCTACTTCTCTCATTATGACCTCTGGTTACATGTTCACTAAGATTAGAAACATGCCT
TATGTTGGTGCCAACGGTTGGATTGCTTCCGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTCGTCGCTTTC
ATTTACGGCCTACTTTCCTTCTCCTTCCTCATGCTCATCTTTGTCGTGCCAAACCAAAAGTCCCCAGCTCGCCAA
CGCGCTCAAGTCTACCTCTGGTCTGCAGTCATAGTCATCATTTATTCCGTTCTTATTTCCCTTTTCCGTCTTAAG
AACCGTGGTTACCCTTTCAAACTCTTCATTTAA
Transcript >AgabiH97|057200
ATGCTCCTCCGCGCCCTCGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCCGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCCGAGGTTTCGACCTCATCACCAGCCCAAAGCGC
ACATGGTCAGTCACTATCCAGCTCACCGCGCTCAGTCAGCGTCATAAATGCACGATGTGCAAGGAATTTCTGCCA
GCGTGGAATGCTGTCGTGCGCGCGTGGACCTCGGTGCCCCAACCCGAGCGTGACAATCACTTCTTTGCCACTCTC
GACTTTGATGACGCTCCTGGCGTGTTCCAAAAGCTCGGTCTCGTAGCTGCACCCGTCGTGTTTACCTGGGCACCT
GCCGAAGGCGATCGCAAGTCTGCCAATACCCTCCCTGACAAATATGATTTCAACGAAGGCTTCGGTGCGGGTCCC
TTTGCTGATTCCGTTTCGAGGCATACTCCCGTCAAAATTCCCTACCGCGAACCCATCGACTGGACACGCCTCATT
CTCACCTGCATCTTTGGTCTTTCCCTTTTACTCGCCCTCCGTTTCGCTTCTCCTCTTTTCCAGTCCCGCTGGACA
TGGGCTTTGGGAACCATCTCTACTTCTCTCATTATGACCTCTGGTTACATGTTCACTAAGATTAGAAACATGCCT
TATGTTGGTGCCAACGGTTGGATTGCTTCCGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTCGTCGCTTTC
ATTTACGGCCTACTTTCCTTCTCCTTCCTCATGCTCATCTTTGTCGTGCCAAACCAAAAGTCCCCAGCTCGCCAA
CGCGCTCAAGTCTACCTCTGGTCTGCAGTCATAGTCATCATTTATTCCGTTCTTATTTCCCTTTTCCGTCTTAAG
AACCGTGGTTACCCTTTCAAACTCTTCATTTAA
Gene >AgabiH97|057200
ATGCTCCTCCGCGCCCTCGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCCGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCCGAGGTTTCGACCTCATCACCAGCCCAAAGCGC
ACATGGTCAGTCACTATCCAGCTCACCGCGCTCAGTCAGCGTCATAAATGCACGATGTGCAAGTATGTCTATTCT
CGCCCTCCTCCTCTTCCCTCCTCACCTTTTCCAGGGAATTTCTGCCAGCGTGGAATGCTGTCGTGCGCGCGTGGA
CCTCGGTGCCCCAACCCGAGCGTGACAATCACTTCTTTGCCACTCTCGACTTTGATGACGCTCCTGGCGTGTTCC
AAAAGGTGAGTCTGCTTCCTCATTTATTACACTATCTTACGCCGCCCCACAGCTCGGTCTCGTAGCTGCACCCGT
CGTGTTTACCTGGGCACCTGCCGAAGGCGATCGCAAGTCTGCCAATACCCTCCCTGACAAATATGATTTCAACGA
GTATGTTTCTGTACCGCTTTGCAACTCTCTCAGCTCATCCTCCTGCTTTTGCTAGAGGCTTCGGTGCGGGTCCCT
TTGCTGATTCCGTTTCGAGGCATACTCCCGTCAAAATTCCCTACCGCGAACCCATCGACTGGACACGCCTCATTC
TCACCTGCATCTTTGGTCTTTCCCTTTTACTCGCCCTCCGTTTCGCTTCTCCTCTTTTCCAGTCCCGCTGGACAT
GGGCTTTGGGAACCATCTCTACTTCTCTCATTATGACCTCTGGTTACATGTTCACTAAGATTAGAAACATGCCTT
ATGTTGGTGCCAACGGTTGGATTGCTTCCGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTCGTCGCTTTCA
TTTGTACGTGTTCTCTCCTCTCATTAACGCGCCTACTCATCATTCCTTGCAGACGGCCTACTTTCCTTCTCCTTC
CTCATGCTCATCTTTGTCGTGCCAAACCAAAAGTCCCCAGCTCGCCAACGCGCTCAAGTCTACCTCTGGTCTGCA
GTCATAGTCATCATTTATTCCGTTCTTATTTCCCTTTTCCGTCTTAAGAACCGTGGTTACCCTTTCAAACTCTTC
ATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail