Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|057130
Gene name
Locationscaffold_3:1083783..1088502
Strand+
Gene length (bp)4719
Transcript length (bp)3933
Coding sequence length (bp)3933
Protein length (aa) 1311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 3.8E-200 7 1247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1263 4.0E-46
sp|Q9FY61|TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana GN=TRS120 PE=1 SV=1 8 931 4.0E-16
sp|Q32PH0|TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus GN=TRAPPC9 PE=1 SV=1 584 794 4.0E-09
sp|Q96Q05|TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens GN=TRAPPC9 PE=1 SV=2 584 794 6.0E-08
sp|Q3U0M1|TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus GN=Trappc9 PE=1 SV=2 584 794 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1263 4.0E-46
sp|Q9FY61|TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana GN=TRS120 PE=1 SV=1 8 931 4.0E-16
sp|Q32PH0|TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus GN=TRAPPC9 PE=1 SV=1 584 794 4.0E-09
sp|Q96Q05|TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens GN=TRAPPC9 PE=1 SV=2 584 794 6.0E-08
sp|Q3U0M1|TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus GN=Trappc9 PE=1 SV=2 584 794 1.0E-07
sp|Q6PA97|TPPC9_XENLA Trafficking protein particle complex subunit 9 OS=Xenopus laevis GN=trappc9 PE=2 SV=1 584 794 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|057130
MDNHAFASLAHVQILLLPVGATPQASFERCVSEIRGFDTIRLGDIPTDAKGERARFMPNPLSAGHLHLNFPTHPP
PPSQYALSLLRPSQFPLAVIGIASFCQTSTLKSIYSQFNAALLDIFPASNQFPLARTCFVFEENDIATNLSASND
LPGVVIIPSMMGNKRLYIGTLLADLCSQILGEFGVVMQALESPFGNEYLNGSLLAALPPLSELPLSLDSDRRGSV
PNFSSPDVLKSDSASTSIPPMKRNSSSGPNYRLGVQPPKKRLSTIGVASSHARLYKMLGDFFLLAGRTEDSTIWY
TEALQLFKNSQDHAWHAAVLEGLATISVVEAWSAGHGLHNSTTSSKEPWSDAIEKLTQATTLYHKSPLYYEGESI
YAPLAYLYSCCVLRHSSLLFAVWSAKGWGPLAFTTMLQPGPKAHLPPTLAHDEADQWLNLERLTKYSGISRSSIS
NVLGQIHGPWLLHLHPRERLSILTTMASVYACLGYKRKEAYLLREVLGCVMDLIVCGREEDGITKVSGPRNTGLG
IENGNITPTNPLTYLDQGILKQVCKTIGIDLDAVKLLHASTQETELAESSQNEASTNDDGSELERPETYGWPELQ
VGVVREAVAVAEALPDFPAVAQFALSSLKTLQTVLSPGDQHHLYSTSMRAITTARRRGDSRFFEYWSGRPVVSVA
LAPVPLVRLPVEKHLSVLSKQKSDLTPIIQGITDPFLYNPRRVTAKKDQEIVAQNEVLEFVVVLQNPFIFDLELQ
CLSLSTSGVKFQSEPVRVVLPASSFHQVVIPGKVMATGILTIRGCFVQAPGGITQEFILPLNTAEEEERITRRKS
ALICEAERYKYWGLESLPWEKPKRSIKYHSSQLNPRTNLRFLECKVVPEQPLLRIRRTSVNHGALMLYEGERSTL
RITLENISLLPIDFVHLAFDDSTIEPAQQALAEGAMSSSDVYETEHSLINQPVFTWNKSEGRFIPPGHTLSLSIS
CFGKSGCTNGNVHVSYSYTHRTDLEQPSDYFYTRQLSHPIMVTVYPMLQCQNMDLIPFPSYMDYIQTPSTTTHHN
NLGVDDGASWCLFSVEVRNVYGSPFEVTFEREQYGTSHSSTTTTIPPGSTSRVVLPLRRTALSEEDTSKPIPTLS
DRQFVVAKDKLSTAELHLQRELFWYREALFKSIQGYWKEVGGTRTGEMSLRQQRMTLPMLEAFKSNVARVDLSLI
SCDLPKENTIDGRRVWKANEFLKLKVRITNLSSFAIPLSLTLDLEPSDCLIYEGVIADIPIGRLDEGMTREIEFP
ICFLTNGHFELVAQVRAVGFDIKPAKAEIIAAVRS*
Coding >AgabiH97|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCAGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGCTCGATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCG
CCGCCGTCTCAATATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTT
TGTCAAACGAGCACATTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAAT
CAGTTTCCGTTGGCCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGCGCGAGTAATGAT
CTTCCTGGAGTGGTAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTG
TGTTCACAGATCCTTGGAGAGTTCGGAGTCGTGATGCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAAC
GGCTCTCTATTAGCTGCTTTACCACCTTTATCCGAGCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTC
CCGAATTTTAGTAGTCCAGACGTGTTGAAGTCGGATTCTGCTTCGACTTCGATTCCGCCCATGAAACGCAATTCA
TCCTCTGGGCCGAACTATCGACTAGGTGTACAGCCTCCCAAAAAGCGATTAAGCACAATTGGCGTAGCTTCATCC
CATGCACGTCTCTACAAAATGCTAGGCGATTTCTTTTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTAT
ACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCTCGAGGGTTTGGCCACC
ATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCA
GACGCCATTGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATC
TATGCTCCCCTTGCGTATCTATATTCTTGCTGTGTGTTGCGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCC
AAGGGATGGGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCG
CATGATGAAGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCA
AATGTCCTTGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACT
ATGGCTAGCGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTA
ATGGATCTTATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGC
ATTGAAAATGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGATTCTTAAACAAGTATGCAAA
ACAATCGGTATTGACCTCGATGCTGTCAAGTTATTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGT
CAGAATGAGGCCAGTACAAATGATGATGGTTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAA
GTGGGTGTTGTCAGGGAAGCAGTCGCGGTGGCGGAAGCCTTGCCGGATTTCCCTGCTGTCGCCCAGTTTGCTTTG
TCGTCTTTGAAAACCCTGCAAACAGTGCTTTCTCCTGGGGATCAACATCACCTGTATTCGACGTCTATGCGTGCC
ATAACGACAGCTCGTCGACGAGGAGACTCGAGATTCTTCGAGTACTGGTCCGGACGACCGGTGGTTAGTGTCGCT
CTCGCCCCTGTACCACTCGTTAGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGATTTA
ACTCCCATCATTCAGGGCATCACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGACCAAGAG
ATCGTGGCTCAGAATGAGGTGCTAGAGTTCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAG
TGCCTCTCGTTAAGTACTTCAGGCGTAAAATTCCAATCCGAGCCGGTCCGCGTTGTCTTGCCAGCGAGTTCATTT
CACCAGGTGGTTATACCAGGCAAAGTTATGGCGACAGGCATTCTCACTATCCGGGGGTGCTTTGTACAAGCACCT
GGTGGTATCACTCAAGAGTTCATACTGCCTCTCAATACGGCAGAGGAGGAAGAGAGGATCACCAGGAGAAAGAGC
GCACTCATATGTGAGGCTGAACGTTACAAGTATTGGGGTTTGGAATCACTTCCATGGGAAAAACCGAAGAGGTCG
ATCAAATACCACTCCAGCCAGCTGAATCCCCGCACAAATTTACGTTTCCTGGAATGTAAGGTGGTCCCTGAGCAA
CCGCTGTTAAGAATACGTAGAACATCGGTCAATCATGGAGCTTTGATGTTATATGAGGGCGAGCGATCAACTCTA
CGCATAACGCTTGAGAATATATCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAA
CCTGCTCAACAGGCGTTAGCGGAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGTCTTATCAAT
CAGCCTGTTTTTACTTGGAACAAAAGTGAAGGTAGGTTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCC
TGTTTCGGAAAATCGGGCTGTACCAATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAA
CAACCATCTGATTATTTTTATACTCGGCAGCTGTCGCATCCTATCATGGTTACCGTCTATCCGATGCTCCAGTGC
CAAAATATGGATTTAATCCCGTTTCCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGCATCATAAT
AATTTGGGTGTAGATGATGGAGCGAGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTC
GAAGTAACATTTGAGCGCGAGCAATACGGGACATCACATTCATCTACTACGACCACCATACCGCCTGGGTCTACA
TCAAGGGTGGTTTTGCCATTGAGGAGGACAGCACTGTCTGAAGAGGATACCTCAAAACCGATACCGACTCTATCG
GATCGGCAATTTGTGGTGGCTAAGGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTCTGGTAT
AGAGAAGCTTTGTTCAAAAGTATTCAGGGTTACTGGAAAGAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTC
CGTCAGCAGCGTATGACATTACCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATA
TCTTGTGATCTACCTAAAGAGAATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAA
GTACGAATAACCAACCTGTCTTCATTTGCAATACCCCTCAGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTG
ATTTACGAGGGTGTCATCGCCGATATTCCTATTGGGCGCTTGGATGAGGGGATGACACGAGAGATTGAGTTTCCC
ATCTGCTTCCTCACGAATGGCCATTTCGAACTCGTAGCACAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCC
AAAGCAGAGATCATCGCGGCTGTCCGCAGTTGA
Transcript >AgabiH97|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCAGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGCTCGATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCG
CCGCCGTCTCAATATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTT
TGTCAAACGAGCACATTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAAT
CAGTTTCCGTTGGCCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGCGCGAGTAATGAT
CTTCCTGGAGTGGTAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTG
TGTTCACAGATCCTTGGAGAGTTCGGAGTCGTGATGCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAAC
GGCTCTCTATTAGCTGCTTTACCACCTTTATCCGAGCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTC
CCGAATTTTAGTAGTCCAGACGTGTTGAAGTCGGATTCTGCTTCGACTTCGATTCCGCCCATGAAACGCAATTCA
TCCTCTGGGCCGAACTATCGACTAGGTGTACAGCCTCCCAAAAAGCGATTAAGCACAATTGGCGTAGCTTCATCC
CATGCACGTCTCTACAAAATGCTAGGCGATTTCTTTTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTAT
ACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCTCGAGGGTTTGGCCACC
ATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCA
GACGCCATTGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATC
TATGCTCCCCTTGCGTATCTATATTCTTGCTGTGTGTTGCGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCC
AAGGGATGGGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCG
CATGATGAAGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCA
AATGTCCTTGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACT
ATGGCTAGCGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTA
ATGGATCTTATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGC
ATTGAAAATGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGATTCTTAAACAAGTATGCAAA
ACAATCGGTATTGACCTCGATGCTGTCAAGTTATTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGT
CAGAATGAGGCCAGTACAAATGATGATGGTTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAA
GTGGGTGTTGTCAGGGAAGCAGTCGCGGTGGCGGAAGCCTTGCCGGATTTCCCTGCTGTCGCCCAGTTTGCTTTG
TCGTCTTTGAAAACCCTGCAAACAGTGCTTTCTCCTGGGGATCAACATCACCTGTATTCGACGTCTATGCGTGCC
ATAACGACAGCTCGTCGACGAGGAGACTCGAGATTCTTCGAGTACTGGTCCGGACGACCGGTGGTTAGTGTCGCT
CTCGCCCCTGTACCACTCGTTAGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGATTTA
ACTCCCATCATTCAGGGCATCACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGACCAAGAG
ATCGTGGCTCAGAATGAGGTGCTAGAGTTCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAG
TGCCTCTCGTTAAGTACTTCAGGCGTAAAATTCCAATCCGAGCCGGTCCGCGTTGTCTTGCCAGCGAGTTCATTT
CACCAGGTGGTTATACCAGGCAAAGTTATGGCGACAGGCATTCTCACTATCCGGGGGTGCTTTGTACAAGCACCT
GGTGGTATCACTCAAGAGTTCATACTGCCTCTCAATACGGCAGAGGAGGAAGAGAGGATCACCAGGAGAAAGAGC
GCACTCATATGTGAGGCTGAACGTTACAAGTATTGGGGTTTGGAATCACTTCCATGGGAAAAACCGAAGAGGTCG
ATCAAATACCACTCCAGCCAGCTGAATCCCCGCACAAATTTACGTTTCCTGGAATGTAAGGTGGTCCCTGAGCAA
CCGCTGTTAAGAATACGTAGAACATCGGTCAATCATGGAGCTTTGATGTTATATGAGGGCGAGCGATCAACTCTA
CGCATAACGCTTGAGAATATATCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAA
CCTGCTCAACAGGCGTTAGCGGAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGTCTTATCAAT
CAGCCTGTTTTTACTTGGAACAAAAGTGAAGGTAGGTTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCC
TGTTTCGGAAAATCGGGCTGTACCAATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAA
CAACCATCTGATTATTTTTATACTCGGCAGCTGTCGCATCCTATCATGGTTACCGTCTATCCGATGCTCCAGTGC
CAAAATATGGATTTAATCCCGTTTCCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGCATCATAAT
AATTTGGGTGTAGATGATGGAGCGAGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTC
GAAGTAACATTTGAGCGCGAGCAATACGGGACATCACATTCATCTACTACGACCACCATACCGCCTGGGTCTACA
TCAAGGGTGGTTTTGCCATTGAGGAGGACAGCACTGTCTGAAGAGGATACCTCAAAACCGATACCGACTCTATCG
GATCGGCAATTTGTGGTGGCTAAGGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTCTGGTAT
AGAGAAGCTTTGTTCAAAAGTATTCAGGGTTACTGGAAAGAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTC
CGTCAGCAGCGTATGACATTACCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATA
TCTTGTGATCTACCTAAAGAGAATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAA
GTACGAATAACCAACCTGTCTTCATTTGCAATACCCCTCAGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTG
ATTTACGAGGGTGTCATCGCCGATATTCCTATTGGGCGCTTGGATGAGGGGATGACACGAGAGATTGAGTTTCCC
ATCTGCTTCCTCACGAATGGCCATTTCGAACTCGTAGCACAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCC
AAAGCAGAGATCATCGCGGCTGTCCGCAGTTGA
Gene >AgabiH97|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCAGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGGTGTGCTACCCGACCACACTCCTCAACTAAGAAGCCGAGCTGACGACAGGTCAAATGCCTAGCTC
GATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCGCCGCCGTCTCAAT
ATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTTTGTCAAACGAGCA
CATTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAATCAGTTTCCGTTGG
CCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGCGCGAGTAATGATCTTCCTGGAGTGG
TAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTGTGTTCACAGATCC
TTGGAGAGTTCGGAGTCGTGGTTCGTAAGCATCTCATATGCTTCGGCACTTGCAAGATTTGACAATATCGTAGAT
GCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAACGGCTCTCTATTAGCTGCTTTACCACCTTTATCCGA
GCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTCCCGAATTTTAGTAGTCCAGACGTGTTGAAGTCGGA
TTCTGCTTCGACTTCGATTCCGCCCATGAAACGCAATTCATCCTCTGGGCCGAACTATCGACTAGGTGTACAGCC
TCCCAAAAAGCGATTAAGCACAATTGGCGTAGCTTCATCCCATGCACGTCTCTACAAAATGCTAGGCGATTTCTT
TTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTGAGTCAATTATCCTCGGTAACCCACCAAGTTAATCAG
CCGAATGAATAGGTATACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCT
CGAGGGTTTGGCCACCATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGGTATTTGTAACCTGAGATAA
CTCATCGCATATTCTAACGAGGGCGTGTCAGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCAGACGCCAT
TGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATCTATGCTCC
CCTTGCGTATCTATATTCTTGCTGTGTGTTGCGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCCAAGGGATG
GGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCGCATGATGA
AGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCAAATGTCCT
TGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACTATGGCTAG
CGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTAATGGATCT
TATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGCATTGAAAA
TGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGTCCGTTGCTGTCAGAATGAGCGAAAGCTC
ATTGGGGAATGACAGTGTGCTCAGGATTCTTAAACAAGTATGCAAAACAATCGGTATTGACCTCGATGCTGTCAA
GTTATTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGTCAGAATGAGGCCAGTACAAATGATGATGG
TTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAAGTGGGTGTTGTCAGGGAAGCAGTCGCGGT
GGCGGAAGCCTTGCCGGGTGAGCTGCAAGATACTGTTTTTAATAATCATTCACTGATGTAGGCCAGATTTCCCTG
CTGTCGCCCAGTTTGCTTTGTCGTCTTTGAAAACCCTGCAAACAGTGCTTTCTCCTGGGGATCAACATCACCTGT
ATTCGACGTCTATGCGTGCCATAACGACAGCTCGTCGACGAGGAGACTCGAGATTCTTCGAGTACTGGTCCGGAC
GACCGGTGGTTAGTGTCGCTCTCGCCCCGTAAGTGGTGGGTCCGTCTGCTATCAGGCTTCGTATTCTGACGAGGT
GTAGTGTACCACTCGTTAGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGATTTAACTC
CCATCATTCAGGGCATCACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGTTTGCGCACGCC
CGATGTATCACCAGACGCACTCACAGATGAATTCGTAGGACCAAGAGATCGTGGCTCAGAATGAGGTGCTAGAGT
TCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAGTGCCTCTCGTTAAGGTGAACTGGACACC
ATGTCGGGCCACAGAGGCATTTTCTCATTTTCTCCCTTAGTACTTCAGGCGTAAAATTCCAATCCGAGCCGGTCC
GCGTTGTCTTGCCAGCGAGTTCATTTCACCAGGTGGTTATACCAGGCAAAGTTATGGCGACAGGCATTCTCACTA
TCCGGGGGTGCTTTGTACAAGCACCTGGTGGTATCACTCAAGAGTTCATACTGCCTCTCAATACGGCAGAGGAGG
AAGAGAGGATCACCAGGAGAAAGAGCGCACTCATATGTGAGGCTGAACGTTACAAGTATTGGGGTTTGGAATCAC
TTCCATGGGAAAAACCGAAGAGGTCGATCAAATACCACTCCAGCCAGCTGAATCCCCGCACAAATTTACGTTTCC
TGGAATGTAAGGTGGTCCCTGAGCAACCGCTGTTAAGAATACGTAGAACATCGGTCAATCATGGAGCTTTGATGT
TATATGAGGGCGAGCGGTGAGTCTCTTTCCAGTGCTAGATATTGCATACTGAAAGGTAATGTAAGATCAACTCTA
CGCATAACGCTTGAGAATATATCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAA
CCTGCTCAACAGGCGTTAGCGGAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGTCTTATCAAT
CAGCCTGTTTTTACTTGGAACAAAAGTGAAGGTAGGTTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCC
TGTTTCGGAAAATCGGGCTGGTGAGTGTCTCTCTTCCCCTCAGCTTCATTACTGATAAGCTTGTCAATAAGTACC
AATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAACAACCATCTGATTATTTTTATACT
CGGCAGCTGTCGCATCCTATCATGGTTACCGTCTATCCGATGCTCCAGTGCCAAAATATGGATTTAATCCCGTTT
CCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGCATCATAATAATTTGGGTGTAGATGATGGAGCG
AGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTCGAAGTAACATTTGAGCGCGAGCAA
TACGGTGCGTCAACCTGGAAGTTCCTGAAAAGATAAACTTGACATATAGACCAGGGACATCACATTCATCTACTA
CGACCACCATACCGCCTGGGTCTACATCAAGGTCTGTAAGCATCGCTAACATTTCTTTAATCTAAACATTGATGA
CGGCATATAGGGTGGTTTTGCCATTGAGGAGGACAGCACTGTCTGAAGAGGATACCTCAAAACCGATACCGACTC
TATCGGATCGGCAATTTGTGGTGGCTAAGGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTCT
GGTATAGAGAAGCTTTGTTCAAAAGTATTCAGGGTTACTGGAAAGAGGTTCGCTCTCTTCAGTCTGTCTTGTTGA
CCAGTGAACTGACTGAAATTGCAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTCCGTCAGCAGCGTATGACA
TTACCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATATCTTGTGATCTACCTAAA
GAGAATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAAGTACGAATAACCAACCTG
TCTTGTGAGTCGGTCCTTGATCTGGACACCGGAAGTTACCCACGAATAAATTCTCCAGCATTTGCAATACCCCTC
AGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTGATTTACGAGGGTGTCATCGCCGATATTCCTATTGGGCGC
TTGGATGAGGGGATGACACGAGAGATTGAGTTTCCCATCTGCTTCCTCACGAATGGCCATTTCGAACTCGTAGCA
CAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCCAAAGCAGAGATCATCGCGGCTGTCCGCAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail