Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056870
Gene name
Locationscaffold_3:1018965..1021223
Strand+
Gene length (bp)2258
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.2E-07 8 82

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05892|COQ11_YEAST MIOREX complex component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ11 PE=1 SV=1 7 217 8.0E-31
sp|O74482|YQJ9_SCHPO Uncharacterized protein C1840.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.09 PE=3 SV=1 7 225 2.0E-26
sp|Q9FVR6|Y1222_ARATH Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana GN=At1g32220 PE=2 SV=1 6 84 9.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056870
MNSALQRILVVGGNGFIGSAVCKAAVARGIQVTSVSSSGRPYRTEKGHTPAWVNKVDWEKGDALQPESFAHLFAD
VSGVVHTLGTLLEDVDGTYKRAISGDGGNPLEKQQQHLGKERSRGTYEVMNREAALRVCEAFISSESSASAGRNV
PRPFVYISAEDIFRPVIPARYIETKWEAERGIETMMANTTDYRGVYIRPSLVYHAHQRPVTTPLAFLLDLSATLH
ARVPPTVPTPSGILQTLSKLLSPDTRRHDKVEAKKAAAGGRGIGDEELKMYQGLSSPGDQRPVTPSALEAMANIL
VIPPIHVDHVADAILASLDSANGVKGVVGVRRMRELIGWKERGGNSESGGKDDYKVQARFER*
Coding >AgabiH97|056870
ATGAACTCTGCTCTGCAACGCATCCTCGTTGTAGGAGGGAACGGATTCATTGGTTCTGCCGTTTGCAAAGCAGCT
GTGGCACGCGGAATTCAGGTCACCAGCGTCAGTTCATCGGGGCGACCATATCGCACTGAGAAAGGACACACGCCG
GCATGGGTGAACAAGGTGGACTGGGAGAAAGGTGATGCTCTTCAACCGGAGTCTTTTGCTCATCTATTTGCGGAC
GTGTCGGGCGTCGTGCATACTCTGGGCACGCTTCTCGAAGATGTAGACGGAACATATAAACGTGCTATCAGTGGA
GACGGAGGAAATCCACTTGAGAAGCAGCAGCAACACCTTGGGAAAGAAAGATCAAGGGGTACCTATGAGGTGATG
AACCGAGAAGCAGCTTTGCGAGTCTGCGAGGCGTTCATTTCCTCGGAATCTTCTGCTAGTGCCGGAAGAAACGTG
CCGCGTCCATTCGTATACATTTCTGCTGAGGACATCTTCCGCCCTGTGATCCCAGCTCGATATATTGAAACAAAA
TGGGAAGCTGAAAGGGGCATTGAAACAATGATGGCTAATACCACTGATTACCGAGGCGTTTACATTCGTCCAAGT
CTCGTCTACCACGCTCATCAACGCCCCGTCACGACACCACTAGCATTCCTCCTAGACCTCTCCGCTACGCTACAT
GCCAGAGTACCTCCAACTGTTCCAACGCCATCGGGCATTCTTCAAACGCTTAGTAAATTACTCTCCCCCGATACA
AGAAGGCATGATAAAGTAGAAGCTAAAAAGGCAGCGGCGGGAGGGCGAGGAATAGGAGACGAGGAACTAAAAATG
TACCAAGGCCTTTCATCTCCAGGTGACCAAAGGCCCGTGACGCCTTCAGCCCTGGAGGCTATGGCCAATATACTA
GTTATCCCACCGATTCACGTGGATCATGTGGCGGATGCGATTTTGGCGAGTTTGGATTCTGCGAATGGTGTTAAA
GGCGTGGTCGGAGTTAGGCGTATGCGGGAACTCATTGGATGGAAAGAACGCGGAGGTAACTCTGAAAGTGGGGGT
AAGGATGATTATAAAGTTCAAGCTAGGTTTGAACGTTGA
Transcript >AgabiH97|056870
ATGAACTCTGCTCTGCAACGCATCCTCGTTGTAGGAGGGAACGGATTCATTGGTTCTGCCGTTTGCAAAGCAGCT
GTGGCACGCGGAATTCAGGTCACCAGCGTCAGTTCATCGGGGCGACCATATCGCACTGAGAAAGGACACACGCCG
GCATGGGTGAACAAGGTGGACTGGGAGAAAGGTGATGCTCTTCAACCGGAGTCTTTTGCTCATCTATTTGCGGAC
GTGTCGGGCGTCGTGCATACTCTGGGCACGCTTCTCGAAGATGTAGACGGAACATATAAACGTGCTATCAGTGGA
GACGGAGGAAATCCACTTGAGAAGCAGCAGCAACACCTTGGGAAAGAAAGATCAAGGGGTACCTATGAGGTGATG
AACCGAGAAGCAGCTTTGCGAGTCTGCGAGGCGTTCATTTCCTCGGAATCTTCTGCTAGTGCCGGAAGAAACGTG
CCGCGTCCATTCGTATACATTTCTGCTGAGGACATCTTCCGCCCTGTGATCCCAGCTCGATATATTGAAACAAAA
TGGGAAGCTGAAAGGGGCATTGAAACAATGATGGCTAATACCACTGATTACCGAGGCGTTTACATTCGTCCAAGT
CTCGTCTACCACGCTCATCAACGCCCCGTCACGACACCACTAGCATTCCTCCTAGACCTCTCCGCTACGCTACAT
GCCAGAGTACCTCCAACTGTTCCAACGCCATCGGGCATTCTTCAAACGCTTAGTAAATTACTCTCCCCCGATACA
AGAAGGCATGATAAAGTAGAAGCTAAAAAGGCAGCGGCGGGAGGGCGAGGAATAGGAGACGAGGAACTAAAAATG
TACCAAGGCCTTTCATCTCCAGGTGACCAAAGGCCCGTGACGCCTTCAGCCCTGGAGGCTATGGCCAATATACTA
GTTATCCCACCGATTCACGTGGATCATGTGGCGGATGCGATTTTGGCGAGTTTGGATTCTGCGAATGGTGTTAAA
GGCGTGGTCGGAGTTAGGCGTATGCGGGAACTCATTGGATGGAAAGAACGCGGAGGTAACTCTGAAAGTGGGGGT
AAGGATGATTATAAAGTTCAAGCTAGGTTTGAACGTTGA
Gene >AgabiH97|056870
ATGAACTCTGCTCTGCAACGCATCCTCGTTGTAGGAGGGAACGGATTCATTGGTAGGCGTCTGCCAAGCCGTGAA
AGTAGCTTATTGGTACTAACTTGTTTGTAGGTTCTGCCGTTTGCAAAGCAGCTGTGGCACGCGGAATTCAGGTCA
CCAGCGTCAGGTCAGTTCATGTGCTTTTGGGCCTGTCGCTGTAGTTTGGTTGACGTCAATATGTTTCCACCGCCC
ATAATATCTCGACCTTCTAGTTCATCGGGGCGACCATATCGCACTGAGAAAGGACACACGCCGGCATGGGTGAAC
AAGGTTGTTACGAAATCTCTCTTTATTCTTTCTTCCCTCTGGCGTTATTTTTCATCTTCGAATTCCCAAGAGCGA
CAGCGAGACATAGTGCTAGTGCGTTCGCCGCGCCTTCGACACTCACACGCGTCTTCACGTTCCATTCTGTCATTC
CATTTTATTAAACGTATGCGCCTGTGAAAACTTCTCCTCTTGAGTTCCACTACTGTATTCGATCTCATTCTAGCC
CTTCATCTTCTGTTGGACGCGTGTTCTCCGCGTGTTTTCTTTGACTTCATTTGGCACCACCAGCTTCAAAGAACC
GCAATCCGCTCCTGCATTTTGCAATGGACATTCTGTTTTTGCGACTCTGCGATCCAGGGACTGCGTGAGCATCCC
CGCGCACCCACGAAGATCAGCGAGTCAATGAACATCAGAGTGGATGCCTGGCTAGTCAAGTAGCAGTCTGTCAAA
AATGACCCAGGAAATGCCCACTCTAATACTTAATCGTTCAAATGTTTATCTCTTCATCTCGTTCATTCTTTCGCA
AACGGATTCGTTACTGACAAAACTTTCGCCGGTTTTATAGGTGGACTGGGAGAAAGGTGATGCTCTTCAACCGGA
GTCTTTTGCTCATCTATTTGCGGACGTGTCGGGCGTCGTGCATACTCTGGGCACGCTTCTCGAAGATGTAGACGG
AACATATAAACGTGCTATCAGGTCCGGAAACGTTCCTGGATTACTCGGCAGTTTCCTTAAAAATGTCGTCGCTAG
TGGAGACGGAGGAAATCCACTTGAGAAGCAGCAGCAACACCTTGGGAAAGAAAGATCAAGGGGTACCTATGAGGT
GATGAACCGAGAAGCAGGTGAGTTTCGCAAAACTTACTTCACACACCCCTTTACCCTATGCCCGCCCCACCTTTC
TTTATCGTTTGTATATTCGACGTCGGCGGCACACAAGTATCGACGTTCTTAATTGCGGCTTGTCCTCCGCGTGGT
ACCTGAATGCCCCTGACCACCTTCCACTCGTGATTCTCCTGGGCCCTAATGCTCCGTGGTCTTCATGTTATGAAC
TCATTTGTACTTTCATAGCTTTGCGAGTCTGCGAGGCGTTCATTTCCTCGGAATCTTCTGCTAGTGCCGGAAGAA
ACGTGCCGCGTCCATTCGTATACATTTCTGCTGAGGACATCTTCCGCCCTGTGATCCCAGCTCGATATATTGAAA
CAAAATGGGAAGCTGAAAGGGGCATTGAAACAATGATGGCTAATACCACTGATTACCGAGGCGTTTACATTCGTC
CAAGTGCGTAGCATACCATTCTTCCTCGTCTGGCATAGGCGTTCTAATTTTGGTCTTTGTGCTTCATCTCCGCTG
TTGTTCGACTATTCATCGCAACACTATGCCTCTTTTTCACTATGCTCGACATGCCGTGTGCGGTGATTCGTTGTA
CATATCCGACATTGGATTTCCTTCTTGCCCCCGCGACACTAGGTCTCGTCTACCACGCTCATCAACGCCCCGTCA
CGACACCACTAGCATTCCTCCTAGACCTCTCCGCTACGCTACATGCCAGAGTACCTCCAACTGTTCCAACGCCAT
CGGGCATTCTTCAAACGCTTAGTAAATTACTCTCCCCCGATACAAGAAGGCATGATAAAGTAGAAGCTAAAAAGG
CAGCGGCGGGAGGGCGAGGAATAGGAGACGAGGAACTAAAAATGTACCAAGGCCTTTCATCTCCAGGTGACCAAA
GGCCCGTGACGCCTTCAGCCCTGGAGGCTATGGCCAATATACTAGTTATCCCACCGATTCACGTGGATCATGTGG
CGGATGCGATTTTGGCGAGTTTGGATTCTGCGAATGGTGTTAAAGGCGTGGTCGGAGTTAGGCGTATGCGGGAAC
TCATTGGATGGAAAGAACGCGGAGGTAACTCTGAAAGTGGGGGTAAGGATGATTATAAAGTTCAAGCTAGGTTTG
AACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail