Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056860
Gene name
Locationscaffold_3:1017398..1018445
Strand+
Gene length (bp)1047
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 1.3E-09 143 239
PF00967 Barwin Barwin family 2.1E-04 156 231

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P73455|Y3177_SYNY3 Uncharacterized protein ssl3177 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ssl3177 PE=4 SV=1 145 242 4.0E-06
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 148 242 1.0E-05

GO

GO Term Description Terminal node
GO:0042742 defense response to bacterium Yes
GO:0050832 defense response to fungus Yes
GO:0051707 response to other organism No
GO:0044419 biological process involved in interspecies interaction between organisms No
GO:0098542 defense response to other organism No
GO:0009617 response to bacterium No
GO:0009607 response to biotic stimulus No
GO:0006950 response to stress No
GO:0043207 response to external biotic stimulus No
GO:0009620 response to fungus No
GO:0008150 biological_process No
GO:0050896 response to stimulus No
GO:0009605 response to external stimulus No
GO:0006952 defense response No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056860
MFTFASFALFALAISSVTALVVPRGPDAPADWSSSLEDYAGYHARYLAISCYTKHNDPAFFDRCCHPLQNGAQPN
PSCPSPSAVDDSLDNDDDCEDDSSSAPTPTASPTTATSPTPAPHNNSAAKEQDTDVDLAVDAHIVQGGIATFYYQ
QGNAGACGHYNSDDALIAAMDYRTYGNTSRKSPLCGKQVEITNTKNHKKVVVTIADACPTCKNKNSIDLSVRAFE
RIATKDEGEVPITWKYL*
Coding >AgabiH97|056860
ATGTTTACCTTCGCCTCCTTCGCTCTTTTTGCTCTCGCCATCTCTTCCGTGACCGCTCTCGTCGTCCCTCGAGGT
CCTGACGCCCCCGCTGACTGGTCCAGCTCTCTCGAGGACTATGCGGGATATCATGCCCGCTATTTGGCTATCAGC
TGCTACACAAAGCACAATGACCCTGCTTTCTTTGACCGCTGCTGCCATCCTCTTCAGAATGGTGCCCAGCCAAAC
CCGTCTTGTCCGTCACCTTCGGCCGTCGATGACAGTTTGGACAATGATGATGACTGCGAGGATGACTCCAGTTCA
GCACCCACCCCAACAGCAAGTCCGACTACTGCAACAAGTCCCACTCCGGCTCCCCACAACAATTCTGCTGCAAAG
GAACAAGATACCGATGTCGACCTCGCCGTAGATGCCCATATCGTTCAGGGCGGAATCGCAACTTTCTATTATCAG
CAAGGCAATGCGGGAGCATGCGGACACTACAACAGCGATGATGCCCTCATTGCCGCCATGGACTACAGAACCTAC
GGGAATACTAGCCGCAAATCGCCTCTTTGCGGCAAACAAGTTGAGATCACAAATACAAAGAACCACAAGAAAGTA
GTCGTAACCATCGCCGACGCATGTCCCACATGCAAGAATAAAAACTCTATCGACCTTTCCGTTCGTGCCTTCGAA
AGAATTGCCACCAAAGACGAGGGCGAGGTTCCCATTACCTGGAAGTATCTCTGA
Transcript >AgabiH97|056860
ATGTTTACCTTCGCCTCCTTCGCTCTTTTTGCTCTCGCCATCTCTTCCGTGACCGCTCTCGTCGTCCCTCGAGGT
CCTGACGCCCCCGCTGACTGGTCCAGCTCTCTCGAGGACTATGCGGGATATCATGCCCGCTATTTGGCTATCAGC
TGCTACACAAAGCACAATGACCCTGCTTTCTTTGACCGCTGCTGCCATCCTCTTCAGAATGGTGCCCAGCCAAAC
CCGTCTTGTCCGTCACCTTCGGCCGTCGATGACAGTTTGGACAATGATGATGACTGCGAGGATGACTCCAGTTCA
GCACCCACCCCAACAGCAAGTCCGACTACTGCAACAAGTCCCACTCCGGCTCCCCACAACAATTCTGCTGCAAAG
GAACAAGATACCGATGTCGACCTCGCCGTAGATGCCCATATCGTTCAGGGCGGAATCGCAACTTTCTATTATCAG
CAAGGCAATGCGGGAGCATGCGGACACTACAACAGCGATGATGCCCTCATTGCCGCCATGGACTACAGAACCTAC
GGGAATACTAGCCGCAAATCGCCTCTTTGCGGCAAACAAGTTGAGATCACAAATACAAAGAACCACAAGAAAGTA
GTCGTAACCATCGCCGACGCATGTCCCACATGCAAGAATAAAAACTCTATCGACCTTTCCGTTCGTGCCTTCGAA
AGAATTGCCACCAAAGACGAGGGCGAGGTTCCCATTACCTGGAAGTATCTCTGA
Gene >AgabiH97|056860
ATGTTTACCTTCGCCTCCTTCGCTCTTTTTGCTCTCGCCATCTCTTCCGTGACCGCTCTCGTCGTCCCTCGAGGT
CCTGACGCCCCCGCTGACTGGTCCAGCTCTCTCGAGGTGCGTTTCTCAGTGTTTGGTCGACCCTGTGACTCATTC
CGTCCTAGGACTATGCGGGATATCATGCCCGCTATTTGGCTATCAGCTGCTACACAAAGCACAATGACCCTGCTT
TCTTTGACCGCTGCTGCCATCCTCTTCAGGTGTGATACCTGTCTATCACCGTACCGTCTTATTTCTAACTCGCAT
CAGAATGGTGCCCAGCCAAACCCGTCTTGTCCGTCACCTTCGGCCGTCGATGACAGTTTGGACAATGATGATGAC
TGCGAGGATGACTCCAGTTCAGCACCCACCCCAACAGCAAGTCCGACTACTGCAACAAGTCCCACTCCGGCTCCC
CACAACAATTCTGCTGCAAAGGAACAAGATACCGATGTCGACCTCGCCGTAGATGCCCATATCGTTCAGGGCGGA
ATGTATGTGACAGATTTGCTGAGACACATCGTTCCTAAGGCTGACCCATCAACTCATAAACAGCGCAACTTTCTA
TTATCAGCAAGGCAATGCGGGAGCATGCGGACACTACAACAGCGATGATGCCCTCATTGCCGCCATGGGTCAGTT
TGCCTTTTCCCGGACGCTGTTGATATCTGATTATTGCGTGAACAGACTACAGAACCTACGGGAATACTAGCCGCA
AATCGCCTCTTTGCGGCAAACAAGTTGAGATCACAAATACAAAGAACCACAAGGCACGTTACATTTTATAACTGG
GGCTATGACGCTGATAGATTTCTCTATCTTGCAGAAAGTAGTCGTAACCATCGCCGACGCATGTCCCACATGCAA
GAATAAAAACTCTATCGACCTTTCCGTTCGTGCCTTCGAAAGAATTGCCACCAAAGACGAGGGCGAGGTTCCCAG
TGCGTTTTGTTATGCTCTCTTATGTTTAAGCTGCTTATGTCTTCTTTCCTAGTTACCTGGAAGTATCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail