Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056820
Gene name
Locationscaffold_3:1010405..1012107
Strand+
Gene length (bp)1702
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.6E-15 76 182
PF13649 Methyltransf_25 Methyltransferase domain 5.3E-14 80 174
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-13 81 176
PF13847 Methyltransf_31 Methyltransferase domain 7.0E-11 79 182
PF08242 Methyltransf_12 Methyltransferase domain 1.6E-09 81 175
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 2.0E-04 72 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 78 180 6.0E-10
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 78 180 2.0E-09
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 79 183 7.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 50 176 8.0E-09
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 50 176 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 78 180 6.0E-10
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 78 180 2.0E-09
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 79 183 7.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 50 176 8.0E-09
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 50 176 4.0E-08
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 78 180 5.0E-08
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 49 180 1.0E-07
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 78 176 1.0E-07
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 49 180 2.0E-07
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 49 180 2.0E-07
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 49 180 2.0E-07
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 49 180 2.0E-07
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 49 180 2.0E-07
sp|Q3A209|UBIE_PELCD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ubiE PE=3 SV=1 47 208 6.0E-07
sp|Q8KF69|MENG_CHLTE Demethylmenaquinone methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menG PE=3 SV=1 68 181 1.0E-06
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 40 188 2.0E-06
sp|B3QLI9|MENG_CHLP8 Demethylmenaquinone methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menG PE=3 SV=1 76 181 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056820
MPSQNSPPAFAYVGEDDSAYFRVLHGRKLNVLNTVYLLPVDEDEVKRSDRYHRLLQFVFHGHNYIGPVKEVLQFG
RQRRILDLGTGGGSWAIAMADEFPRAEVVGVDLAPIQPSLRFLVIVPSNCTFELCDLDQYPIPYPDGYFDLIHAR
SMHTGIRDYPSFLREIARLLRPGGLVHLIEPDLHPVFSNGSVPVAAPQHPNPSPSFLPATPPPSSPFAEPGTDVN
PIVVPSPPNSNVSSPVVTSSADRGSIAREQRGWIELWETYRSCLRLQGIDVSVPEHLSDLLSDTGQFEKIVVQDG
NIPVGFWPKDENLLTVGQLQWMDYELFLPALKPLFLSRGIPPSQVDRIINLAQHDLYYPTTCQSTRLHIVHAFKR
WC*
Coding >AgabiH97|056820
ATGCCCAGCCAAAACAGCCCCCCGGCCTTCGCCTATGTCGGCGAGGACGACTCGGCCTACTTTCGCGTCCTCCAC
GGCAGAAAACTCAATGTTCTCAACACTGTCTATCTCCTCCCCGTCGACGAGGACGAAGTCAAGCGCTCAGACCGT
TACCACCGTCTGCTTCAGTTTGTCTTCCATGGCCACAACTACATAGGCCCCGTGAAAGAGGTCCTCCAATTCGGC
CGACAACGAAGAATCCTAGACTTGGGCACCGGCGGTGGCTCCTGGGCGATAGCCATGGCTGACGAGTTCCCGCGT
GCAGAAGTAGTTGGCGTCGACCTAGCCCCCATTCAGCCAAGCCTGCGCTTCCTCGTAATCGTCCCGTCTAATTGC
ACTTTTGAGCTTTGTGACCTCGATCAGTACCCTATCCCTTATCCAGATGGCTACTTTGACCTCATTCACGCTCGT
TCAATGCATACTGGTATTCGTGATTATCCAAGTTTCCTCCGGGAGATCGCGCGTCTTCTCCGTCCAGGTGGTCTC
GTCCATCTGATAGAGCCCGATTTGCACCCCGTGTTCTCGAATGGTTCGGTACCAGTCGCTGCCCCACAACACCCT
AACCCATCCCCTTCGTTTTTACCGGCTACGCCACCCCCAAGTTCCCCATTTGCAGAACCCGGGACCGATGTGAAT
CCCATTGTCGTTCCAAGTCCACCCAATTCAAACGTGTCCTCTCCCGTCGTGACTTCTTCCGCCGACCGTGGTTCC
ATTGCTCGCGAACAACGGGGATGGATTGAACTCTGGGAAACATATCGGTCTTGTTTGCGCCTCCAAGGAATTGAT
GTCTCCGTTCCAGAACATCTTTCAGATCTCCTCTCTGACACCGGCCAGTTTGAGAAAATCGTGGTGCAGGATGGA
AACATTCCAGTCGGCTTTTGGCCCAAAGACGAGAATCTTTTAACCGTCGGTCAACTACAATGGATGGATTACGAA
CTTTTTCTTCCCGCTCTCAAGCCCTTATTCCTCTCTCGAGGTATTCCCCCCTCCCAAGTTGATCGAATAATAAAT
CTTGCCCAGCATGATCTTTATTATCCAACAACCTGTCAATCTACCCGCCTTCATATAGTCCATGCATTCAAACGT
TGGTGCTGA
Transcript >AgabiH97|056820
ATGCCCAGCCAAAACAGCCCCCCGGCCTTCGCCTATGTCGGCGAGGACGACTCGGCCTACTTTCGCGTCCTCCAC
GGCAGAAAACTCAATGTTCTCAACACTGTCTATCTCCTCCCCGTCGACGAGGACGAAGTCAAGCGCTCAGACCGT
TACCACCGTCTGCTTCAGTTTGTCTTCCATGGCCACAACTACATAGGCCCCGTGAAAGAGGTCCTCCAATTCGGC
CGACAACGAAGAATCCTAGACTTGGGCACCGGCGGTGGCTCCTGGGCGATAGCCATGGCTGACGAGTTCCCGCGT
GCAGAAGTAGTTGGCGTCGACCTAGCCCCCATTCAGCCAAGCCTGCGCTTCCTCGTAATCGTCCCGTCTAATTGC
ACTTTTGAGCTTTGTGACCTCGATCAGTACCCTATCCCTTATCCAGATGGCTACTTTGACCTCATTCACGCTCGT
TCAATGCATACTGGTATTCGTGATTATCCAAGTTTCCTCCGGGAGATCGCGCGTCTTCTCCGTCCAGGTGGTCTC
GTCCATCTGATAGAGCCCGATTTGCACCCCGTGTTCTCGAATGGTTCGGTACCAGTCGCTGCCCCACAACACCCT
AACCCATCCCCTTCGTTTTTACCGGCTACGCCACCCCCAAGTTCCCCATTTGCAGAACCCGGGACCGATGTGAAT
CCCATTGTCGTTCCAAGTCCACCCAATTCAAACGTGTCCTCTCCCGTCGTGACTTCTTCCGCCGACCGTGGTTCC
ATTGCTCGCGAACAACGGGGATGGATTGAACTCTGGGAAACATATCGGTCTTGTTTGCGCCTCCAAGGAATTGAT
GTCTCCGTTCCAGAACATCTTTCAGATCTCCTCTCTGACACCGGCCAGTTTGAGAAAATCGTGGTGCAGGATGGA
AACATTCCAGTCGGCTTTTGGCCCAAAGACGAGAATCTTTTAACCGTCGGTCAACTACAATGGATGGATTACGAA
CTTTTTCTTCCCGCTCTCAAGCCCTTATTCCTCTCTCGAGGTATTCCCCCCTCCCAAGTTGATCGAATAATAAAT
CTTGCCCAGCATGATCTTTATTATCCAACAACCTGTCAATCTACCCGCCTTCATATAGTCCATGCATTCAAACGT
TGGTGCTGA
Gene >AgabiH97|056820
ATGCCCAGCCAAAACAGCCCCCCGGCCTTCGCCTATGTCGGCGAGGACGACTCGGCCTACTTTCGCGTCCTCCAC
GGCAGAAAACTCAATGTTCTCAACACTGTCTATCTCCTCCCCGTCGACGAGGACGAAGTCAAGGTATCTCCAGTT
CTTTCCTGGCCTTGCACCACCTCATCCCGTCTCTTTTTCAGCGCTCAGACCGTTACCACCGTCTGCTTCAGTTTG
TCTTCCATGGCCACAACTACATAGGCCCCGTGAAAGAGGTCCTCCAATTCGGCCGACAACGAAGAAGTACGCCTT
GGCAGCTTCTAATAAGCACGTTGACCAATTGAACCTTTCAGTCCTAGACTTGGGCACCGGCGGTGGCTCCTGGTC
TGTAAATGGATTCGCTCCTTCATCACCCACCCCATGCTCATTCGCAAACCCCCAGGGCGATAGCCATGGCTGACG
AGTTCCCGCGTGCAGAAGTAGTTGGCGTCGACCTAGCCCCCATTCAGCCAAGGTATCCGTCCCTTGTGTCTTTCT
TTTTGCTGAGCCGAATAACCTTCCAAGCCTGCGCTTCCTCGTGTCCGTGCGGCCCGCGTGAAGGTACTGACACAA
CCCTTTTCGCCATAGAATCGTCCCGTCTAATTGCACGTACGTATACATTTGCGCTTTCATGAACACCCTGCCTTG
ATCTGATACCTTGGCTCAGTTTTGAGCTTTGTGACCTCGATCAGTACCCTATCCCTTATCCAGATGGCTACTTTG
ACCTCATTCACGCTCGTTCAATGCATACTGGTGTGCGTTTTCCCTCAACCTGTCTATTCCCTCACCTCATTATTC
CTTTTTCCAATTTTCTCCGCTGAAATCGCTCTTTTCTTGCATATGTCATGCTTCTCTTCTTTTGCCAAACAAATA
TTCAGATTCGTGATTATCCAAGTTTCCTCCGGGAGATCGCGCGTCTTCTCCGTCCAGGTGGTCTCGTCCATCTGA
TAGAGCCCGATTTGCACCCCGTGTTCTCGAATGGTTCGGTACCAGTCGCTGCCCCACAACACCCTAACCCATCCC
CTTCGTTTTTACCGGCTACGCCACCCCCAAGTTCCCCATTTGCAGAACCCGGGACCGATGTGAATCCCATTGTCG
TTCCAAGTCCACCCAATTCAAACGTGTCCTCTCCCGTCGTGACTTCTTCCGCCGACCGTGGTTCCATTGCTCGCG
AACAACGGGGATGGATTGAACTCTGGGAAACATATCGGTCTTGTTTGCGCCTCCAAGGAATTGATGTCTCCGTTC
CAGAACATCTTTCAGATCTCCTCTCTGACACCGGCCAGTTTGAGAAAATCGTGGTGCAGGATGGAAACATTCCAG
TCGGCTTTTGGCCCAAAGGTAATCGTCAAGTTCTGATCGACTCCCCCCGCACCAGTAATATCACTAACCAACATT
TTTCGGCTATCAATTTCTGATTTTTCTTTTTATTATTTTTCGACGATTGACATAACTTGTGTCCAACGTAGACGA
GAATCTTTTAACCGTCGGTCAACTACAATGGATGGATTACGAACTTTTTCTTCCCGCTCTCAAGCCCTTATTCCT
CTCTCGAGGTATTCCCCCCTCCCAAGTTGATCGAATAATAAATCTTGCCCAGCATGATCTTTATTATCCAACAAC
CTGTCAATCTACCCGCCTTCATATAGTCCATGCATTCAAACGTTGGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail