Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056580
Gene name
Locationscaffold_3:947249..948553
Strand+
Gene length (bp)1304
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05007 Mannosyl_trans Mannosyltransferase (PIG-M) 8.7E-35 171 363
PF06728 PIG-U GPI transamidase subunit PIG-U 4.0E-15 81 294
PF09594 GT87 Glycosyltransferase family 87 3.4E-07 89 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 18 366 2.0E-56
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 27 373 1.0E-51
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 20 342 3.0E-50
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 34 341 5.0E-50
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 16 306 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 18 366 2.0E-56
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 27 373 1.0E-51
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 20 342 3.0E-50
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 34 341 5.0E-50
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 16 306 2.0E-49
sp|Q66IJ4|PIGM_XENTR GPI mannosyltransferase 1 OS=Xenopus tropicalis GN=pigm PE=2 SV=1 27 359 4.0E-49
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 19 342 6.0E-49
sp|Q6BHI9|GPI14_DEBHA GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI14 PE=3 SV=2 16 298 9.0E-49
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 26 373 8.0E-48
sp|Q7T310|PIGM_DANRE GPI mannosyltransferase 1 OS=Danio rerio GN=pigm PE=2 SV=1 37 304 2.0E-47
sp|Q5RAH7|PIGM_PONAB GPI mannosyltransferase 1 OS=Pongo abelii GN=PIGM PE=2 SV=1 28 359 3.0E-43
sp|Q9H3S5|PIGM_HUMAN GPI mannosyltransferase 1 OS=Homo sapiens GN=PIGM PE=1 SV=1 28 359 3.0E-43
sp|Q5AMR5|GPI14_CANAL GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI14 PE=3 SV=1 24 298 6.0E-43
sp|Q9EQY6|PIGM_RAT GPI mannosyltransferase 1 OS=Rattus norvegicus GN=Pigm PE=2 SV=1 28 359 1.0E-42
sp|Q4R4E1|PIGM_MACFA GPI mannosyltransferase 1 OS=Macaca fascicularis GN=PIGM PE=2 SV=1 28 359 2.0E-42
sp|P47088|GPI14_YEAST GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI14 PE=1 SV=2 24 351 2.0E-41
sp|Q8C2R7|PIGM_MOUSE GPI mannosyltransferase 1 OS=Mus musculus GN=Pigm PE=2 SV=2 28 359 3.0E-41
sp|Q5EA10|PIGM_BOVIN GPI mannosyltransferase 1 OS=Bos taurus GN=PIGM PE=2 SV=1 28 359 1.0E-40
sp|Q6FXQ5|GPI14_CANGA GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI14 PE=3 SV=1 24 360 2.0E-40
sp|Q9P6R5|GPI14_SCHPO GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi14 PE=3 SV=2 27 366 3.0E-39
sp|Q75C82|GPI14_ASHGO GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI14 PE=3 SV=1 23 376 2.0E-37
sp|Q6CRE7|GPI14_KLULA GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI14 PE=3 SV=1 28 296 7.0E-36
sp|Q9BPQ5|PIGM_TRYB2 GPI mannosyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIGM PE=2 SV=2 32 305 1.0E-35
sp|Q5F380|PIGM_CHICK GPI mannosyltransferase 1 OS=Gallus gallus GN=PIGM PE=2 SV=2 15 308 2.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0051751 alpha-1,4-mannosyltransferase activity Yes
GO:0004376 glycolipid mannosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009247 glycolipid biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0043412 macromolecule modification No
GO:0006497 protein lipidation No
GO:0044255 cellular lipid metabolic process No
GO:0005575 cellular_component No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0036211 protein modification process No
GO:0031224 intrinsic component of membrane No
GO:0044249 cellular biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0046467 membrane lipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0009987 cellular process No
GO:0006644 phospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0000030 mannosyltransferase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016740 transferase activity No
GO:0006643 membrane lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:0090407 organophosphate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17
2 180 202 22
3 212 231 19
4 252 274 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 44.80 25.86 63.73
Initials Initials knots 42.94 24.70 61.17
Pileal_Stipeal_center Stage I stipe center 49.30 28.75 69.86
Pileal_Stipeal_shell Stage I stipe shell 49.41 28.58 70.23
DIF_stipe_center Stage II stipe center 53.96 31.68 76.24
DIF_stipe_shell Stage II stipe shell 51.40 30.07 72.74
DIF_stipe_skin Stage II stipe skin 49.96 29.15 70.77
DIF_cap_skin Stage II cap skin 58.95 34.63 83.27
DIF_cap_tissue Stage II cap tissue 57.39 33.85 80.92
DIF_gill_tissue Stage II gill tissue 55.26 32.49 78.02
YFB_stipe_center Young fruiting body stipe center 54.90 32.30 77.49
YFB_stipe_shell Young fruiting body stipe shell 52.04 30.44 73.64
YFB_stipe_skin Young fruiting body stipe skin 53.30 31.28 75.32
YFB_cap_skin Young fruiting body cap skin 59.49 35.18 83.79
YFB_cap_tissue Young fruiting body cap tissue 56.40 33.25 79.54
YFB_gill_tissue Young fruiting body gill tissue 58.57 34.36 82.79
YFB_veil Young fruiting body veil 54.85 32.16 77.54

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.593805 no
Casing YFB_stipe_center 0.614751 no
Casing YFB_stipe_shell 0.739428 no
Casing YFB_stipe_skin 0.681334 no
Casing YFB_cap_skin 0.407453 no
Casing YFB_cap_tissue 0.545481 no
Casing YFB_gill_tissue 0.457696 no
Casing YFB_veil 0.616231 no
Casing Initials 0.941284 no
Casing Pileal_Stipeal_center 0.847122 no
Casing Pileal_Stipeal_shell 0.848746 no
Casing DIF_stipe_center 0.648744 no
Casing DIF_stipe_shell 0.760163 no
Casing DIF_stipe_skin 0.821770 no
Casing DIF_cap_skin 0.442465 no
Casing DIF_cap_tissue 0.494241 no
DIF_gill_tissue YFB_stipe_center 0.990921 no
DIF_gill_tissue YFB_stipe_shell 0.910343 no
DIF_gill_tissue YFB_stipe_skin 0.946397 no
DIF_gill_tissue YFB_cap_skin 0.883025 no
DIF_gill_tissue YFB_cap_tissue 0.971104 no
DIF_gill_tissue YFB_gill_tissue 0.912906 no
DIF_gill_tissue YFB_veil 0.989666 no
YFB_stipe_center YFB_stipe_shell 0.921763 no
YFB_stipe_center YFB_stipe_skin 0.957229 no
YFB_stipe_center YFB_cap_skin 0.872557 no
YFB_stipe_center YFB_cap_tissue 0.962410 no
YFB_stipe_center YFB_gill_tissue 0.902907 no
YFB_stipe_center YFB_veil 0.998314 no
YFB_stipe_shell YFB_stipe_skin 0.965981 no
YFB_stipe_shell YFB_cap_skin 0.757470 no
YFB_stipe_shell YFB_cap_tissue 0.873999 no
YFB_stipe_shell YFB_gill_tissue 0.799526 no
YFB_stipe_shell YFB_veil 0.923942 no
YFB_stipe_skin YFB_cap_skin 0.810176 no
YFB_stipe_skin YFB_cap_tissue 0.919232 no
YFB_stipe_skin YFB_gill_tissue 0.847768 no
YFB_stipe_skin YFB_veil 0.960344 no
YFB_cap_skin YFB_cap_tissue 0.920629 no
YFB_cap_skin YFB_gill_tissue 0.978298 no
YFB_cap_skin YFB_veil 0.870176 no
YFB_cap_tissue YFB_gill_tissue 0.946708 no
YFB_cap_tissue YFB_veil 0.961017 no
YFB_gill_tissue YFB_veil 0.901696 no
Initials DIF_gill_tissue 0.487385 no
Initials YFB_stipe_center 0.503521 no
Initials YFB_stipe_shell 0.637732 no
Initials YFB_stipe_skin 0.578763 no
Initials YFB_cap_skin 0.309722 no
Initials YFB_cap_tissue 0.438501 no
Initials YFB_gill_tissue 0.359772 no
Initials YFB_veil 0.510519 no
Initials Pileal_Stipeal_center 0.758946 no
Initials Pileal_Stipeal_shell 0.762268 no
Initials DIF_stipe_center 0.542093 no
Initials DIF_stipe_shell 0.657556 no
Initials DIF_stipe_skin 0.728626 no
Initials DIF_cap_skin 0.344759 no
Initials DIF_cap_tissue 0.388159 no
Pileal_Stipeal_center DIF_gill_tissue 0.802540 no
Pileal_Stipeal_center YFB_stipe_center 0.817480 no
Pileal_Stipeal_center YFB_stipe_shell 0.919765 no
Pileal_Stipeal_center YFB_stipe_skin 0.875093 no
Pileal_Stipeal_center YFB_cap_skin 0.624182 no
Pileal_Stipeal_center YFB_cap_tissue 0.758763 no
Pileal_Stipeal_center YFB_gill_tissue 0.673436 no
Pileal_Stipeal_center YFB_veil 0.822361 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.996834 no
Pileal_Stipeal_center DIF_stipe_center 0.849288 no
Pileal_Stipeal_center DIF_stipe_shell 0.937770 no
Pileal_Stipeal_center DIF_stipe_skin 0.980603 no
Pileal_Stipeal_center DIF_cap_skin 0.659591 no
Pileal_Stipeal_center DIF_cap_tissue 0.712426 no
Pileal_Stipeal_shell DIF_gill_tissue 0.815664 no
Pileal_Stipeal_shell YFB_stipe_center 0.829726 no
Pileal_Stipeal_shell YFB_stipe_shell 0.925699 no
Pileal_Stipeal_shell YFB_stipe_skin 0.884042 no
Pileal_Stipeal_shell YFB_cap_skin 0.637637 no
Pileal_Stipeal_shell YFB_cap_tissue 0.774640 no
Pileal_Stipeal_shell YFB_gill_tissue 0.688180 no
Pileal_Stipeal_shell YFB_veil 0.834740 no
Pileal_Stipeal_shell DIF_stipe_center 0.859544 no
Pileal_Stipeal_shell DIF_stipe_shell 0.943077 no
Pileal_Stipeal_shell DIF_stipe_skin 0.983944 no
Pileal_Stipeal_shell DIF_cap_skin 0.673977 no
Pileal_Stipeal_shell DIF_cap_tissue 0.729033 no
DIF_stipe_center DIF_gill_tissue 0.967266 no
DIF_stipe_center YFB_stipe_center 0.974650 no
DIF_stipe_center YFB_stipe_shell 0.949977 no
DIF_stipe_center YFB_stipe_skin 0.982188 no
DIF_stipe_center YFB_cap_skin 0.838877 no
DIF_stipe_center YFB_cap_tissue 0.938686 no
DIF_stipe_center YFB_gill_tissue 0.873037 no
DIF_stipe_center YFB_veil 0.977185 no
DIF_stipe_center DIF_stipe_shell 0.930074 no
DIF_stipe_center DIF_stipe_skin 0.880406 no
DIF_stipe_center DIF_cap_skin 0.863152 no
DIF_stipe_center DIF_cap_tissue 0.905517 no
DIF_stipe_shell DIF_gill_tissue 0.886951 no
DIF_stipe_shell YFB_stipe_center 0.900073 no
DIF_stipe_shell YFB_stipe_shell 0.982458 no
DIF_stipe_shell YFB_stipe_skin 0.948000 no
DIF_stipe_shell YFB_cap_skin 0.728301 no
DIF_stipe_shell YFB_cap_tissue 0.850601 no
DIF_stipe_shell YFB_gill_tissue 0.772867 no
DIF_stipe_shell YFB_veil 0.901940 no
DIF_stipe_shell DIF_stipe_skin 0.959293 no
DIF_stipe_shell DIF_cap_skin 0.758620 no
DIF_stipe_shell DIF_cap_tissue 0.810120 no
DIF_stipe_skin DIF_gill_tissue 0.831485 no
DIF_stipe_skin YFB_stipe_center 0.845344 no
DIF_stipe_skin YFB_stipe_shell 0.940787 no
DIF_stipe_skin YFB_stipe_skin 0.899983 no
DIF_stipe_skin YFB_cap_skin 0.658389 no
DIF_stipe_skin YFB_cap_tissue 0.789842 no
DIF_stipe_skin YFB_gill_tissue 0.707255 no
DIF_stipe_skin YFB_veil 0.848884 no
DIF_stipe_skin DIF_cap_skin 0.692542 no
DIF_stipe_skin DIF_cap_tissue 0.745673 no
DIF_cap_skin DIF_gill_tissue 0.901585 no
DIF_cap_skin YFB_stipe_center 0.892077 no
DIF_cap_skin YFB_stipe_shell 0.790385 no
DIF_cap_skin YFB_stipe_skin 0.835568 no
DIF_cap_skin YFB_cap_skin 0.987527 no
DIF_cap_skin YFB_cap_tissue 0.938213 no
DIF_cap_skin YFB_gill_tissue 0.991727 no
DIF_cap_skin YFB_veil 0.891825 no
DIF_cap_skin DIF_cap_tissue 0.961376 no
DIF_cap_tissue DIF_gill_tissue 0.945139 no
DIF_cap_tissue YFB_stipe_center 0.934988 no
DIF_cap_tissue YFB_stipe_shell 0.839932 no
DIF_cap_tissue YFB_stipe_skin 0.882281 no
DIF_cap_tissue YFB_cap_skin 0.947023 no
DIF_cap_tissue YFB_cap_tissue 0.975384 no
DIF_cap_tissue YFB_gill_tissue 0.970902 no
DIF_cap_tissue YFB_veil 0.933905 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056580
MFTAGKESHGKLMIPSFKNVLYASIALRVALILYSEWHDARSIVKYTDVDYRVFTDAARFILQPSAANRARGPIL
NQLALGDPYARDTYRYTPLLALILTPNIFLHPSFGKYVFAACDILNGLIIYNVLVNHILTTDPEQEKTDSTLIAK
MKTQATLYTAIHLLNPMVFSISTRGSSESLLLAFVLLTLHALLNDRWTIAAIFLGLSTHWKIYPVIYGVSSVCLI
GSLSSHSKHKSGGLTGWLKMVVNLRTVSFALVSAGTFLLLGGFCYAIWGYPFLYESYLYHLHRLDHRHNFSPYFY
PTYLSYPSLDTQSAPPTASPSAWNTMLESPLTSFFPQLILSLGTGLLSSYTKADLPFSCTFYGISFFCLSFSQTS
ACHA*
Coding >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGATCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACT
CCCAACATCTTCCTTCACCCTTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATC
TATAACGTACTCGTGAACCATATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAG
ATGAAAACACAGGCGACATTGTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGA
TCATCTGAATCCTTACTCTTGGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCA
GCCATATTTTTGGGATTGAGTACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATC
GGCTCCCTCAGCTCGCATTCCAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGG
ACCGTGAGTTTTGCTCTCGTCAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATCTGGGGATAT
CCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCGACTTGATCATCGACATAATTTCTCTCCATACTTCTAT
CCAACGTATCTCAGCTACCCTTCTCTGGATACACAATCAGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACC
ATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACTTATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTAC
ACCAAAGCCGACCTGCCATTCTCTTGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCTTCTCCCAAACCTCC
GCATGTCACGCGTAA
Transcript >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGATCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACT
CCCAACATCTTCCTTCACCCTTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATC
TATAACGTACTCGTGAACCATATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAG
ATGAAAACACAGGCGACATTGTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGA
TCATCTGAATCCTTACTCTTGGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCA
GCCATATTTTTGGGATTGAGTACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATC
GGCTCCCTCAGCTCGCATTCCAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGG
ACCGTGAGTTTTGCTCTCGTCAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATCTGGGGATAT
CCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCGACTTGATCATCGACATAATTTCTCTCCATACTTCTAT
CCAACGTATCTCAGCTACCCTTCTCTGGATACACAATCAGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACC
ATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACTTATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTAC
ACCAAAGCCGACCTGCCATTCTCTTGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCTTCTCCCAAACCTCC
GCATGTCACGCGTAA
Gene >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGAGTAAGTACCTGACTTTACTGCAAGCCGACCCCTTGCAGCGTTCTGACCCGAGCAG
TCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACTCCCAACATCTTCCTTCACCC
TTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATCTATAACGTACTCGTGAACCA
TATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAGATGAAAACACAGGCGACATT
GTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGATCATCTGAATCCTTACTCTT
GGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCAGCCATATTTTTGGGATTGAG
TACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATCGGCTCCCTCAGCTCGCATTC
CAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGGACCGTGAGTTTTGCTCTCGT
CAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATGTAGGTTATTTCCTCCTTTATGGCACCCTT
TATTCCAAGGCTTAACCACTCTTTTAGCTGGGGATATCCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCG
ACTTGATCATCGACATAATTTCTCTCCATACTTCTATCCAACGTATCTCAGCTACCCTTCTCTGGATACACAATC
AGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACCATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACT
TATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTACACCAAAGCCGACCTGCCATTCTCTTGGTTCGTTCAGAC
CTGCTGTTTTGTCATATTCAATAAAGTCTGCACATCACAGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCT
TCTCCCAAACCTCCGCATGTCACGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail