Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056580
Gene name
Locationscaffold_3:947249..948553
Strand+
Gene length (bp)1304
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05007 Mannosyl_trans Mannosyltransferase (PIG-M) 8.7E-35 171 363
PF06728 PIG-U GPI transamidase subunit PIG-U 4.0E-15 81 294
PF09594 GT87 Glycosyltransferase family 87 3.4E-07 89 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 18 366 2.0E-56
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 27 373 1.0E-51
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 20 342 3.0E-50
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 34 341 5.0E-50
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 16 306 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 18 366 2.0E-56
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 27 373 1.0E-51
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 20 342 3.0E-50
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 34 341 5.0E-50
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 16 306 2.0E-49
sp|Q66IJ4|PIGM_XENTR GPI mannosyltransferase 1 OS=Xenopus tropicalis GN=pigm PE=2 SV=1 27 359 4.0E-49
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 19 342 6.0E-49
sp|Q6BHI9|GPI14_DEBHA GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI14 PE=3 SV=2 16 298 9.0E-49
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 26 373 8.0E-48
sp|Q7T310|PIGM_DANRE GPI mannosyltransferase 1 OS=Danio rerio GN=pigm PE=2 SV=1 37 304 2.0E-47
sp|Q5RAH7|PIGM_PONAB GPI mannosyltransferase 1 OS=Pongo abelii GN=PIGM PE=2 SV=1 28 359 3.0E-43
sp|Q9H3S5|PIGM_HUMAN GPI mannosyltransferase 1 OS=Homo sapiens GN=PIGM PE=1 SV=1 28 359 3.0E-43
sp|Q5AMR5|GPI14_CANAL GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI14 PE=3 SV=1 24 298 6.0E-43
sp|Q9EQY6|PIGM_RAT GPI mannosyltransferase 1 OS=Rattus norvegicus GN=Pigm PE=2 SV=1 28 359 1.0E-42
sp|Q4R4E1|PIGM_MACFA GPI mannosyltransferase 1 OS=Macaca fascicularis GN=PIGM PE=2 SV=1 28 359 2.0E-42
sp|P47088|GPI14_YEAST GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI14 PE=1 SV=2 24 351 2.0E-41
sp|Q8C2R7|PIGM_MOUSE GPI mannosyltransferase 1 OS=Mus musculus GN=Pigm PE=2 SV=2 28 359 3.0E-41
sp|Q5EA10|PIGM_BOVIN GPI mannosyltransferase 1 OS=Bos taurus GN=PIGM PE=2 SV=1 28 359 1.0E-40
sp|Q6FXQ5|GPI14_CANGA GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI14 PE=3 SV=1 24 360 2.0E-40
sp|Q9P6R5|GPI14_SCHPO GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi14 PE=3 SV=2 27 366 3.0E-39
sp|Q75C82|GPI14_ASHGO GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI14 PE=3 SV=1 23 376 2.0E-37
sp|Q6CRE7|GPI14_KLULA GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI14 PE=3 SV=1 28 296 7.0E-36
sp|Q9BPQ5|PIGM_TRYB2 GPI mannosyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIGM PE=2 SV=2 32 305 1.0E-35
sp|Q5F380|PIGM_CHICK GPI mannosyltransferase 1 OS=Gallus gallus GN=PIGM PE=2 SV=2 15 308 2.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0051751 alpha-1,4-mannosyltransferase activity Yes
GO:0004376 glycolipid mannosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009247 glycolipid biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0043412 macromolecule modification No
GO:0006497 protein lipidation No
GO:0044255 cellular lipid metabolic process No
GO:0005575 cellular_component No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0036211 protein modification process No
GO:0031224 intrinsic component of membrane No
GO:0044249 cellular biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0046467 membrane lipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0009987 cellular process No
GO:0006644 phospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0000030 mannosyltransferase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016740 transferase activity No
GO:0006643 membrane lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:0090407 organophosphate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17
2 180 202 22
3 212 231 19
4 252 274 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056580
MFTAGKESHGKLMIPSFKNVLYASIALRVALILYSEWHDARSIVKYTDVDYRVFTDAARFILQPSAANRARGPIL
NQLALGDPYARDTYRYTPLLALILTPNIFLHPSFGKYVFAACDILNGLIIYNVLVNHILTTDPEQEKTDSTLIAK
MKTQATLYTAIHLLNPMVFSISTRGSSESLLLAFVLLTLHALLNDRWTIAAIFLGLSTHWKIYPVIYGVSSVCLI
GSLSSHSKHKSGGLTGWLKMVVNLRTVSFALVSAGTFLLLGGFCYAIWGYPFLYESYLYHLHRLDHRHNFSPYFY
PTYLSYPSLDTQSAPPTASPSAWNTMLESPLTSFFPQLILSLGTGLLSSYTKADLPFSCTFYGISFFCLSFSQTS
ACHA*
Coding >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGATCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACT
CCCAACATCTTCCTTCACCCTTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATC
TATAACGTACTCGTGAACCATATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAG
ATGAAAACACAGGCGACATTGTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGA
TCATCTGAATCCTTACTCTTGGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCA
GCCATATTTTTGGGATTGAGTACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATC
GGCTCCCTCAGCTCGCATTCCAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGG
ACCGTGAGTTTTGCTCTCGTCAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATCTGGGGATAT
CCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCGACTTGATCATCGACATAATTTCTCTCCATACTTCTAT
CCAACGTATCTCAGCTACCCTTCTCTGGATACACAATCAGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACC
ATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACTTATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTAC
ACCAAAGCCGACCTGCCATTCTCTTGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCTTCTCCCAAACCTCC
GCATGTCACGCGTAA
Transcript >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGATCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACT
CCCAACATCTTCCTTCACCCTTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATC
TATAACGTACTCGTGAACCATATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAG
ATGAAAACACAGGCGACATTGTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGA
TCATCTGAATCCTTACTCTTGGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCA
GCCATATTTTTGGGATTGAGTACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATC
GGCTCCCTCAGCTCGCATTCCAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGG
ACCGTGAGTTTTGCTCTCGTCAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATCTGGGGATAT
CCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCGACTTGATCATCGACATAATTTCTCTCCATACTTCTAT
CCAACGTATCTCAGCTACCCTTCTCTGGATACACAATCAGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACC
ATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACTTATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTAC
ACCAAAGCCGACCTGCCATTCTCTTGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCTTCTCCCAAACCTCC
GCATGTCACGCGTAA
Gene >AgabiH97|056580
ATGTTCACTGCGGGAAAAGAGTCCCACGGCAAGCTCATGATACCCTCCTTCAAGAATGTCCTCTACGCGAGCATA
GCCCTCCGGGTAGCCTTGATTCTTTACAGTGAATGGCATGATGCCAGGTCCATCGTCAAGTACACAGACGTCGAC
TATCGCGTTTTCACGGATGCAGCCCGTTTCATCCTCCAGCCAAGCGCGGCTAACAGGGCACGAGGACCAATACTC
AACCAACTTGCTTTAGGAGAGTAAGTACCTGACTTTACTGCAAGCCGACCCCTTGCAGCGTTCTGACCCGAGCAG
TCCCTACGCCAGAGACACCTACCGCTACACACCGCTCCTCGCCCTGATACTCACTCCCAACATCTTCCTTCACCC
TTCCTTTGGCAAATATGTTTTCGCTGCCTGCGATATCCTCAATGGTCTTATCATCTATAACGTACTCGTGAACCA
TATTCTCACAACGGATCCGGAACAAGAGAAAACGGATTCGACATTAATTGCCAAGATGAAAACACAGGCGACATT
GTACACGGCCATCCATCTTCTCAATCCTATGGTGTTTTCCATCTCAACTCGGGGATCATCTGAATCCTTACTCTT
GGCTTTTGTTCTCCTCACTCTTCATGCCCTTCTTAACGACCGCTGGACTATCGCAGCCATATTTTTGGGATTGAG
TACTCATTGGAAAATCTACCCCGTCATATATGGTGTAAGCTCTGTGTGTCTCATCGGCTCCCTCAGCTCGCATTC
CAAACATAAGAGCGGTGGCTTGACGGGTTGGTTGAAAATGGTCGTGAATCTGCGGACCGTGAGTTTTGCTCTCGT
CAGTGCTGGAACATTTCTTCTCCTCGGAGGTTTTTGTTATGCCATGTAGGTTATTTCCTCCTTTATGGCACCCTT
TATTCCAAGGCTTAACCACTCTTTTAGCTGGGGATATCCTTTTCTTTACGAATCCTACCTCTATCACCTGCACCG
ACTTGATCATCGACATAATTTCTCTCCATACTTCTATCCAACGTATCTCAGCTACCCTTCTCTGGATACACAATC
AGCTCCTCCTACGGCCTCCCCCTCCGCATGGAATACCATGCTTGAGTCACCACTAACGTCTTTCTTCCCTCAACT
TATCCTTTCACTTGGGACGGGCCTTCTCTCCAGCTACACCAAAGCCGACCTGCCATTCTCTTGGTTCGTTCAGAC
CTGCTGTTTTGTCATATTCAATAAAGTCTGCACATCACAGTACTTTTTATGGTATCTCCTTTTTTTGCCTTTCCT
TCTCCCAAACCTCCGCATGTCACGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail