Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056560
Gene name
Locationscaffold_3:943649..945123
Strand-
Gene length (bp)1474
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10607 CTLH CTLH/CRA C-terminal to LisH motif domain 3.0E-18 104 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9PTY5|RANB9_XENLA Ran-binding protein 9 OS=Xenopus laevis GN=ranbp9 PE=2 SV=1 42 311 8.0E-08
sp|Q28FM1|RANB9_XENTR Ran-binding protein 9 OS=Xenopus tropicalis GN=ranbp9 PE=2 SV=1 42 311 9.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056560
MPPPPTPASSTAQTTSSTPVASSSRSTKPSKGSLTNPTPYQLRSLVMDYLCHHCYTRTALAFAKDGTVRHLDADG
DEIVQPQDKGIFAGRDALELSNETLREAELRNDIRVKILSGNVDDAIELLNEHFPSSAKHLIPTTTDPRHLLLNL
RILGFTELCRTKPLIYSSPSLRTNEIDMSESDLVIQHDSTQAKNVDSEMNDNVDTDAEADTDVDGTASESSTQDV
HDLAPHTATVESNGDSKVELMIHQGQKLYALLEQIDHPAEKELYKKELVNVGALLAYPEPEDSPLARYLSMERRE
AVAEQINKAILTRMGQSPTSNIEVITRYTTVLWALANEMKVKARPGATVPPVQQLPRPPTPPLPAKQVPEGDQRQ
VVPAFNLQTFLDLR*
Coding >AgabiH97|056560
ATGCCGCCTCCGCCTACTCCAGCGTCCTCAACGGCGCAGACTACCTCGAGTACCCCAGTTGCCTCTTCCAGCAGG
AGCACTAAACCGTCTAAAGGATCACTCACAAATCCTACGCCCTATCAGCTGCGGTCTTTGGTCATGGATTATCTC
TGTCATCATTGCTACACCCGTACCGCCTTGGCGTTCGCGAAGGACGGCACAGTACGCCACTTGGACGCTGACGGG
GATGAGATCGTTCAGCCACAAGACAAGGGTATTTTTGCGGGCCGGGATGCCTTGGAACTGAGTAACGAAACGTTA
AGAGAGGCAGAACTCCGTAATGACATTCGGGTCAAGATTCTCTCTGGAAATGTTGATGATGCCATCGAACTGCTT
AACGAACACTTCCCTTCTTCGGCTAAACATCTGATACCGACGACCACGGATCCTCGACACCTCCTTCTCAACCTT
CGCATCCTTGGATTTACAGAACTCTGTAGGACAAAACCTTTGATATACTCTTCTCCTTCTCTTCGGACAAATGAG
ATCGATATGTCAGAGTCGGATCTAGTCATCCAGCATGATAGTACTCAGGCTAAAAACGTCGACTCAGAGATGAAT
GATAACGTGGACACGGATGCAGAAGCAGACACCGATGTGGACGGAACTGCCAGTGAATCCAGTACTCAGGATGTT
CATGATCTCGCTCCTCACACCGCGACTGTCGAATCGAACGGGGATTCGAAAGTTGAATTAATGATCCACCAAGGT
CAGAAGTTGTATGCGCTCTTGGAACAAATAGACCACCCAGCGGAAAAGGAGCTTTACAAAAAGGAATTGGTTAAT
GTAGGAGCATTGTTGGCGTATCCTGAACCGGAAGATAGTCCTCTGGCGAGGTATTTATCGATGGAACGGCGAGAG
GCTGTCGCTGAACAGATCAATAAGGCGATTCTCACTCGAATGGGTCAATCACCAACGTCGAATATCGAAGTCATA
ACAAGGTACACAACAGTACTTTGGGCTTTGGCCAACGAGATGAAGGTCAAGGCAAGACCTGGCGCGACTGTCCCG
CCCGTCCAGCAGCTACCGAGACCACCAACGCCGCCTCTCCCTGCGAAACAAGTACCTGAAGGTGATCAGCGGCAG
GTCGTACCAGCTTTCAATCTCCAGACATTCTTGGACTTGCGATAG
Transcript >AgabiH97|056560
ATGCCGCCTCCGCCTACTCCAGCGTCCTCAACGGCGCAGACTACCTCGAGTACCCCAGTTGCCTCTTCCAGCAGG
AGCACTAAACCGTCTAAAGGATCACTCACAAATCCTACGCCCTATCAGCTGCGGTCTTTGGTCATGGATTATCTC
TGTCATCATTGCTACACCCGTACCGCCTTGGCGTTCGCGAAGGACGGCACAGTACGCCACTTGGACGCTGACGGG
GATGAGATCGTTCAGCCACAAGACAAGGGTATTTTTGCGGGCCGGGATGCCTTGGAACTGAGTAACGAAACGTTA
AGAGAGGCAGAACTCCGTAATGACATTCGGGTCAAGATTCTCTCTGGAAATGTTGATGATGCCATCGAACTGCTT
AACGAACACTTCCCTTCTTCGGCTAAACATCTGATACCGACGACCACGGATCCTCGACACCTCCTTCTCAACCTT
CGCATCCTTGGATTTACAGAACTCTGTAGGACAAAACCTTTGATATACTCTTCTCCTTCTCTTCGGACAAATGAG
ATCGATATGTCAGAGTCGGATCTAGTCATCCAGCATGATAGTACTCAGGCTAAAAACGTCGACTCAGAGATGAAT
GATAACGTGGACACGGATGCAGAAGCAGACACCGATGTGGACGGAACTGCCAGTGAATCCAGTACTCAGGATGTT
CATGATCTCGCTCCTCACACCGCGACTGTCGAATCGAACGGGGATTCGAAAGTTGAATTAATGATCCACCAAGGT
CAGAAGTTGTATGCGCTCTTGGAACAAATAGACCACCCAGCGGAAAAGGAGCTTTACAAAAAGGAATTGGTTAAT
GTAGGAGCATTGTTGGCGTATCCTGAACCGGAAGATAGTCCTCTGGCGAGGTATTTATCGATGGAACGGCGAGAG
GCTGTCGCTGAACAGATCAATAAGGCGATTCTCACTCGAATGGGTCAATCACCAACGTCGAATATCGAAGTCATA
ACAAGGTACACAACAGTACTTTGGGCTTTGGCCAACGAGATGAAGGTCAAGGCAAGACCTGGCGCGACTGTCCCG
CCCGTCCAGCAGCTACCGAGACCACCAACGCCGCCTCTCCCTGCGAAACAAGTACCTGAAGGTGATCAGCGGCAG
GTCGTACCAGCTTTCAATCTCCAGACATTCTTGGACTTGCGATAG
Gene >AgabiH97|056560
ATGCCGCCTCCGCCTACTCCAGCGTCCTCAACGGCGCAGACTACCTCGAGTACCCCAGTTGCCTCTTCCAGCAGG
AGCACTAAACCGTCTAAAGGATCACTCACAAATCCTACGCCCTATCAGCTGGTAAGTTACCCCGCACACGACTGT
TTACATCACCGTTGTTGTTGAATTGAAACCGAACCAAATTCCACAGCGGTCTTTGGTCATGGATTATCTCTGTCA
TCATTGCTACACCCGTACCGCCTTGGCGTTCGCGAAGGACGGCACAGTACGCCACTTGGACGCTGACGGGGATGA
GATCGTTCAGCCACAAGACAAGGGTATTTTTGCGGGCCGGGATGCCTTGGAACTGAGTAACGAAACGTTAAGAGA
GGCAGAACTCCGTAATGGTGCGTCATTCGTGTATGCTGGTTTCCGTTTGAGGGCAGATCTCATGATTATTTCATG
GCCCGTAGACATTCGGGTCAAGATTCTCTCTGGAAATGTTGATGATGCCATCGAACTGCTTAACGAACACTTCCC
TTCTGTACTTGGGCTTTCCACGCCCCAATGCAAAATCTTACCCTTCTTCGCTGGAAGCTATGAAGTCGGCTAAAC
ATCTGATACCGACGACCACGGATCCTCGACACCTCCTTCTCAACCTTCGCATCCTTGGATTTACAGAACTCTGTA
GGACAAAACCTTTGATATACTCTTCTCCTTCTCTTCGGACAAATGAGATCGATATGTCAGAGTCGGATCTAGTCA
TCCAGCATGATAGTACTCAGGCTAAAAACGTCGACTCAGAGATGAATGATAACGTGGACACGGATGCAGAAGCAG
ACACCGATGTGGACGGAACTGCCAGTGAATCCAGTACTCAGGATGTTCATGATCTCGCTCCTCACACCGCGACTG
TCGAATCGAACGGGGATTCGAAAGTTGAATTAATGATCCACCAAGGTCAGAAGTTGTATGCGCTCTTGGAACAAA
TAGACCACCCAGCGGAAAAGGAGCTTTACAAAAAGGAATTGGTTAATGTAGGAGCATTGTTGGCGTATCCTGAAC
CGGAAGATAGTCCTCTGGCGAGGTATTTATCGATGGAACGGCGAGAGGCTGTCGCTGAACAGATCAATAAGGCGA
TTCTCAGTCAGTTCACTCCTTCTCGTTTTGGAATTTGTGTAGGTGCTAATGATAGAACGTTTAGCTCGAATGGGT
CAATCACCAACGTCGAATATCGAAGTCATAACAAGGTACACAACAGTACTTTGGGCTTTGGCCAACGAGATGAAG
GTCAAGGCAAGACCTGGCGCGACTGTCCCGCCCGTCCAGCAGCTACCGAGACCACCAACGCCGCCTCTCCCTGCG
AAACAAGTACCTGAAGGTGATCAGGTAAGGAAATCGTGATGAGTTAAATGGATCGCTGATGCACTTTTTGTAGCG
GCAGGTCGTACCAGCTTTCAATCTCCAGACATTCTTGGACTTGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail