Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056500
Gene name
Locationscaffold_3:931192..932901
Strand-
Gene length (bp)1709
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03152 UFD1 Ubiquitin fusion degradation protein UFD1 7.8E-70 37 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 34 392 3.0E-60
sp|O42915|UFD1_SCHPO Ubiquitin fusion degradation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd1 PE=2 SV=4 15 393 4.0E-60
sp|Q9VTF9|UFD1_DROME Ubiquitin fusion degradation protein 1 homolog OS=Drosophila melanogaster GN=Ufd1-like PE=2 SV=1 36 290 1.0E-58
sp|Q9ES53|UFD1_RAT Ubiquitin fusion degradation protein 1 homolog OS=Rattus norvegicus GN=Ufd1l PE=1 SV=1 35 222 3.0E-55
sp|P70362|UFD1_MOUSE Ubiquitin fusion degradation protein 1 homolog OS=Mus musculus GN=Ufd1l PE=1 SV=2 35 222 4.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 34 392 3.0E-60
sp|O42915|UFD1_SCHPO Ubiquitin fusion degradation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd1 PE=2 SV=4 15 393 4.0E-60
sp|Q9VTF9|UFD1_DROME Ubiquitin fusion degradation protein 1 homolog OS=Drosophila melanogaster GN=Ufd1-like PE=2 SV=1 36 290 1.0E-58
sp|Q9ES53|UFD1_RAT Ubiquitin fusion degradation protein 1 homolog OS=Rattus norvegicus GN=Ufd1l PE=1 SV=1 35 222 3.0E-55
sp|P70362|UFD1_MOUSE Ubiquitin fusion degradation protein 1 homolog OS=Mus musculus GN=Ufd1l PE=1 SV=2 35 222 4.0E-55
sp|Q92890|UFD1_HUMAN Ubiquitin fusion degradation protein 1 homolog OS=Homo sapiens GN=UFD1L PE=1 SV=3 35 221 3.0E-54
sp|Q55BK0|UFD1_DICDI Ubiquitin fusion degradation protein 1 homolog OS=Dictyostelium discoideum GN=ufd1 PE=3 SV=1 15 214 4.0E-48
sp|Q19584|UFD1_CAEEL Ubiquitin fusion degradation protein 1 homolog OS=Caenorhabditis elegans GN=ufd-1 PE=3 SV=1 36 295 2.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0008152 metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056500
MNMDFIGGPNGPGGLLAQLAGGFPYGPGRTSRNPNSFDEYLKAYSVAMLPGRQRENVSYGGKVIMPPSALASLTN
LEVEGPWTFQLRNPANSAASTHAGVLEFIAEEGVVHLPYWMMKTLRLNEGDPIRITGTELVKGKFVKLQAQTVHF
LEISDPKAVLEQALRNFSALTQGDIIEISYNSIVFGLLVMETKPGGEGISILDTDLEVDFAAPVGYVEPERPKAS
ALPTMASRLNIDLNSNSPGSSRPGSSMAVPFSGASTTGQTAMSKDGDHWESFKGKGETLGGRKTKGKGISHRKVE
EVPEGSKIIRTDKTRIVNNAMLESEAKVPAALNLPFGHLFFGFNVAQYTPPSPPPGSPTLGSQSPPQTFSGSGQT
LNGRTMDSSKASSSEKGKEKEPTKSYSWGSGGNALGSRNTAVGAGGASVPRPQNRSKRPVQKERSPTPDFGVDDD
DDVIMISDDE*
Coding >AgabiH97|056500
ATGAATATGGATTTTATTGGCGGTCCAAATGGACCAGGCGGCCTGCTCGCTCAACTTGCTGGAGGTTTTCCCTAT
GGCCCCGGCAGGACAAGCAGGAATCCAAACTCCTTCGATGAATATCTGAAAGCGTATAGCGTTGCAATGTTGCCT
GGCCGGCAACGAGAAAATGTTTCGTACGGTGGAAAAGTTATTATGCCACCGTCTGCTTTAGCGAGCCTTACCAAT
CTTGAGGTTGAGGGACCGTGGACATTTCAGCTTCGGAACCCTGCCAATTCGGCAGCGTCCACACATGCTGGTGTC
CTCGAATTCATTGCCGAAGAGGGTGTTGTACATCTCCCGTACTGGATGATGAAAACTCTTCGACTCAATGAAGGT
GACCCTATTCGCATCACCGGAACAGAATTGGTGAAAGGCAAGTTTGTCAAGCTACAGGCTCAGACAGTTCATTTC
TTGGAGATTTCGGATCCTAAAGCAGTGCTTGAACAAGCGTTGCGGAATTTTTCGGCTTTAACTCAAGGTGACATC
ATCGAAATCTCTTACAACTCCATCGTTTTCGGATTGCTGGTGATGGAAACAAAACCTGGGGGCGAAGGCATAAGC
ATTCTCGATACTGATCTTGAAGTTGACTTTGCTGCCCCGGTCGGATATGTTGAGCCAGAACGGCCTAAGGCTTCT
GCCCTGCCTACCATGGCCTCCAGACTCAACATTGACTTGAACTCAAATTCCCCCGGTTCGTCAAGGCCCGGGTCA
TCTATGGCTGTTCCGTTTTCCGGTGCAAGTACAACAGGGCAAACAGCAATGAGTAAAGATGGTGACCATTGGGAA
AGTTTCAAAGGTAAAGGCGAAACCTTGGGGGGAAGGAAGACGAAAGGGAAAGGTATCAGTCACAGAAAAGTTGAA
GAGGTGCCAGAAGGAAGCAAAATTATCCGCACAGACAAAACACGCATCGTGAATAATGCAATGTTAGAGTCCGAG
GCCAAAGTTCCAGCAGCATTAAACCTTCCTTTCGGCCACCTGTTCTTCGGATTCAATGTTGCTCAATATACTCCA
CCATCCCCCCCTCCCGGCTCTCCCACGCTTGGCTCGCAGTCACCACCTCAAACATTCAGTGGTTCGGGTCAGACG
TTGAATGGCCGTACAATGGATTCATCGAAGGCGTCGTCATCTGAAAAGGGCAAAGAAAAGGAACCAACAAAATCC
TACAGCTGGGGTAGTGGCGGTAACGCCCTTGGATCCCGGAATACTGCGGTTGGTGCGGGCGGCGCGAGCGTCCCA
AGGCCACAGAACCGTAGCAAGCGCCCGGTACAAAAAGAACGGAGCCCAACTCCAGATTTCGGTGTAGATGATGAC
GATGATGTGATCATGATCAGCGACGACGAGTGA
Transcript >AgabiH97|056500
ATGAATATGGATTTTATTGGCGGTCCAAATGGACCAGGCGGCCTGCTCGCTCAACTTGCTGGAGGTTTTCCCTAT
GGCCCCGGCAGGACAAGCAGGAATCCAAACTCCTTCGATGAATATCTGAAAGCGTATAGCGTTGCAATGTTGCCT
GGCCGGCAACGAGAAAATGTTTCGTACGGTGGAAAAGTTATTATGCCACCGTCTGCTTTAGCGAGCCTTACCAAT
CTTGAGGTTGAGGGACCGTGGACATTTCAGCTTCGGAACCCTGCCAATTCGGCAGCGTCCACACATGCTGGTGTC
CTCGAATTCATTGCCGAAGAGGGTGTTGTACATCTCCCGTACTGGATGATGAAAACTCTTCGACTCAATGAAGGT
GACCCTATTCGCATCACCGGAACAGAATTGGTGAAAGGCAAGTTTGTCAAGCTACAGGCTCAGACAGTTCATTTC
TTGGAGATTTCGGATCCTAAAGCAGTGCTTGAACAAGCGTTGCGGAATTTTTCGGCTTTAACTCAAGGTGACATC
ATCGAAATCTCTTACAACTCCATCGTTTTCGGATTGCTGGTGATGGAAACAAAACCTGGGGGCGAAGGCATAAGC
ATTCTCGATACTGATCTTGAAGTTGACTTTGCTGCCCCGGTCGGATATGTTGAGCCAGAACGGCCTAAGGCTTCT
GCCCTGCCTACCATGGCCTCCAGACTCAACATTGACTTGAACTCAAATTCCCCCGGTTCGTCAAGGCCCGGGTCA
TCTATGGCTGTTCCGTTTTCCGGTGCAAGTACAACAGGGCAAACAGCAATGAGTAAAGATGGTGACCATTGGGAA
AGTTTCAAAGGTAAAGGCGAAACCTTGGGGGGAAGGAAGACGAAAGGGAAAGGTATCAGTCACAGAAAAGTTGAA
GAGGTGCCAGAAGGAAGCAAAATTATCCGCACAGACAAAACACGCATCGTGAATAATGCAATGTTAGAGTCCGAG
GCCAAAGTTCCAGCAGCATTAAACCTTCCTTTCGGCCACCTGTTCTTCGGATTCAATGTTGCTCAATATACTCCA
CCATCCCCCCCTCCCGGCTCTCCCACGCTTGGCTCGCAGTCACCACCTCAAACATTCAGTGGTTCGGGTCAGACG
TTGAATGGCCGTACAATGGATTCATCGAAGGCGTCGTCATCTGAAAAGGGCAAAGAAAAGGAACCAACAAAATCC
TACAGCTGGGGTAGTGGCGGTAACGCCCTTGGATCCCGGAATACTGCGGTTGGTGCGGGCGGCGCGAGCGTCCCA
AGGCCACAGAACCGTAGCAAGCGCCCGGTACAAAAAGAACGGAGCCCAACTCCAGATTTCGGTGTAGATGATGAC
GATGATGTGATCATGATCAGCGACGACGAGTGA
Gene >AgabiH97|056500
ATGAATATGGATTTTGTATGTTCCAGAAGTTAACTGGCTATACGGCCACTGATAAACCTGCCTAGATTGGCGGTC
CAAATGGACCAGGCGGCCTGCTCGCTCAACTTGCTGGGTAGGACCCTCTCCCCAGGCTATCGTTCTGCGCCACAT
TTAATATTTAAACTCAGAGGTTTTCCCTATGGCCCCGGCAGGACAAGCAGGAATCCAAACTCCTTCGATGAATAT
CTGAAAGCGTATAGCGTTGCAATGTTGCCTGGCCGGCAACGAGAAAATGTTTCGTACGGTGGAAAAGGTATGTCG
AAATCTAATCCGCCTTTTCCGAGATTGTCTCCTAATTATGGCTTTAGTTATTATGCCACCGTCTGCTTTAGCGAG
CCTTACCAATCTTGAGGTTGAGGGACCGTGGACATTTCAGCTTCGGAACCCTGCCAATTCGGCAGCGTCCACACA
TGCTGGTGTCCTCGAATTCATTGCCGAAGAGGGTGTTGTACATCTCCCGTACTGGATGATGAAAACTCTTCGACT
CAATGAAGGTGACCCTATTCGCATCACCGGAACAGAATTGGTGAAAGGCAAGTTTGTCAAGCTACAGGCTCAGAC
AGTTCATTTCTTGGAGATTTCGGATCCTAAAGCAGTGTGATTATGACAAATGGCTCTCCCTAGGAAGTATCATTA
ACGATTATTTAGGCTTGAACAAGCGTTGCGGAATTTTTCGGCTTTAACTCAAGGTGACATCATCGAAATCTCTTA
CAACTCCATCGTTTTCGGATTGCTGGTGATGGAAACAAAACCTGGGGGCGAAGGCATAAGCATTCTCGATACTGA
TCTTGAAGTTGACTTTGCTGCCCCGGTCGGATATGTTGAGCCAGAACGGCCTAAGGCTTCTGCCCTGCCTACCAT
GGCCTCCAGACTCAACATTGACTTGAACTCAAATTCCCCCGGTTCGTCAAGGCCCGGGTCATCTATGGCTGTTCC
GTTTTCCGGTGCAAGTACAACAGGGCAAACAGCAATGAGTAAAGATGGTGACCATTGGGAAAGTTTCAAAGGTAA
AGGCGAAACCTTGGGGGGAAGGAAGACGAAAGGGAAAGGTATCAGTCACAGAAAAGTTGAAGAGGTGCCAGAAGG
AAGCAAAATTATCCGCACAGAGTAAGCGAACTGCTCAACAGTCCAGCAGTGATCCACCGAGCTCATTTTTCTATC
TTTACAGCAAAACACGCATCGTGAATAATGCAATGTTAGAGTCCGAGGCCAAAGTTCCAGCAGCATTAAACCTTC
CTTTCGGCCACCTGTTCTTCGGATTCAATGTTGCTCAATATACTCCACCATCCCCCCCTCCCGGCTCTCCCACGC
TTGGCTCGCAGGTTGGTCGCATCGTTTGACGGTTTATGAAACCATCTAACATTATACTTTTCCAGTCACCACCTC
AAACATTCAGTGGTTCGGGTCAGACGTTGAATGGCCGTACAATGGATTCATCGAAGGCGTCGTCATCTGAAAAGG
GCAAAGAAAAGGAACCAACAAAATCCTACAGCTGGGGTAGTGGCGGTAACGCCCTTGGATCCCGGAATACTGCGG
TTGGTGCGGGCGGCGCGAGCGTCCCAAGGCCACAGAACCGTAGCAAGCGCCCGGTACAAAAAGAACGGAGCCCAA
CTCCAGATTTCGGTGTAGATGATGACGATGATGTGATCATGATCAGCGACGACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail